[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56417.1
DDBJ      :             protein of unknown function DUF6 transmembrane
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:347 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  190->267 1s7bA  f.39.1.1 * 8e-04 9.0 %
:HMM:SCOP  43->144 1s7bA_ f.39.1.1 * 1.6e-05 29.7 %
:HMM:SCOP  188->294 1s7bA_ f.39.1.1 * 1e-11 31.4 %
:RPS:PFM   214->267 PF00892 * EamA 3e-04 46.3 %
:HMM:PFM   19->138 PF00892 * EamA 8.1e-11 24.2 120/126  
:HMM:PFM   163->284 PF00892 * EamA 1.9e-20 28.3 120/126  
:BLT:SWISS 14->267 Y788_ARCFU 5e-09 26.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56417.1 GT:GENE ACV56417.1 GT:PRODUCT protein of unknown function DUF6 transmembrane GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2882875..2883918) GB:FROM 2882875 GB:TO 2883918 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF6 transmembrane GB:NOTE PFAM: protein of unknown function DUF6 transmembrane; KEGG: rlt:Rleg2_2742 protein of unknown function DUF6 transmembrane GB:PROTEIN_ID ACV56417.1 GB:DB_XREF GI:257476097 InterPro:IPR000620 LENGTH 347 SQ:AASEQ MKTRSKRWPYVACVVLQTVIFGSGNAITKMAYESITPMWCLAIRFGLAALVFAIFFGPRIVRQLKGARIGAWMPAALCMALAYLTCNVALDLTTATNVGFLVALPVVFAPLLSCLVNRRRYPLAFLPFQAAVVVGLYLLCSNGGAPSFGLGEILALLSSVALAGALVFGERGLEQLDATTVAGTQIVASFVVALACALVFEPPVNVAAVQPVAWGTIAFLALLSTCLTFMLQNVALTELPSSTVSLLLTGEPVFTAAFSFMLLGEALSAAGMAGAVVIVASVVAATWVEGRQSAPAASPAPQAEHALALEEGWFEGAEFGAQSSLAGVELPHLAPSERRSFASERAA GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 14->267|Y788_ARCFU|5e-09|26.7|240/308| TM:NTM 10 TM:REGION 11->33| TM:REGION 37->59| TM:REGION 69->91| TM:REGION 96->117| TM:REGION 124->146| TM:REGION 148->170| TM:REGION 185->207| TM:REGION 215->237| TM:REGION 242->264| TM:REGION 269->291| SEG 100->112|flvalpvvfapll| SEG 154->167|lallssvalagalv| SEG 202->213|ppvnvaavqpva| SEG 268->285|saagmagavvivasvvaa| SEG 292->303|qsapaaspapqa| SEG 306->321|alaleegwfegaefga| RP:PFM:NREP 1 RP:PFM:REP 214->267|PF00892|3e-04|46.3|54/125|EamA| HM:PFM:NREP 2 HM:PFM:REP 19->138|PF00892|8.1e-11|24.2|120/126|EamA| HM:PFM:REP 163->284|PF00892|1.9e-20|28.3|120/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 1 RP:SCP:REP 190->267|1s7bA|8e-04|9.0|78/106|f.39.1.1| HM:SCP:REP 43->144|1s7bA_|1.6e-05|29.7|101/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 188->294|1s7bA_|1e-11|31.4|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 335-335,339-342| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcc //