[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56422.1
DDBJ      :             peptidase M50
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:364 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   73->124 2a61A PDBj 1e-04 13.5 %
:RPS:SCOP  73->124 2a61A1  a.4.5.28 * 3e-05 13.5 %
:HMM:SCOP  78->124 1ku9A_ a.4.5.36 * 0.00016 25.5 %
:RPS:PFM   12->84,258->350 PF02163 * Peptidase_M50 4e-13 47.2 %
:HMM:PFM   10->351 PF02163 * Peptidase_M50 2.2e-46 35.4 189/193  
:BLT:SWISS 1->74 Y118_BORBU 1e-11 37.8 %
:BLT:SWISS 244->347 RSEP_PHOLU 2e-05 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56422.1 GT:GENE ACV56422.1 GT:PRODUCT peptidase M50 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2889371..2890465) GB:FROM 2889371 GB:TO 2890465 GB:DIRECTION - GB:PRODUCT peptidase M50 GB:NOTE PFAM: peptidase M50; KEGG: gdi:GDI2146 putative metalloprotease MmpA GB:PROTEIN_ID ACV56422.1 GB:DB_XREF GI:257476102 InterPro:IPR008915 LENGTH 364 SQ:AASEQ MDIVLMIVYATLILGFLVFIHEGGHYLAARAFGVRVTEFMLGLPGPNIGFTKWGTKFGVTPFLLGGYAKVCGMEPGEMSPYLEPVLAALYRRGTANMEDIARDCGITDDAAYEALDELVEWGSIAGPTKQDKYNTYRAPVVKPSKKQVAAGAVAYELGQARPVEDAHALFESEYKQQYRSLPFWKRSVILVAGVAVNLLFAVLLFVVLFSLIGVDVQTSAGDIRHVNVNPLDAIQMGFMYIGMVVQLIAGLFNPSTAGEVVQNSTSVIGIAAMSKQAVDLGLASAISFVASISVSLGIMNLLPILPLDGGRFVIEVFQKISRKVVTMRALNYLSAAGMILFIGFFLFMANQDIQRIISGAGFGG GT:EXON 1|1-364:0| BL:SWS:NREP 2 BL:SWS:REP 1->74|Y118_BORBU|1e-11|37.8|74/437| BL:SWS:REP 244->347|RSEP_PHOLU|2e-05|27.9|104/226| TM:NTM 6 TM:REGION 2->24| TM:REGION 49->71| TM:REGION 190->212| TM:REGION 230->252| TM:REGION 282->304| TM:REGION 332->354| SEG 190->209|lvagvavnllfavllfvvlf| SEG 283->295|asaisfvasisvs| RP:PDB:NREP 1 RP:PDB:REP 73->124|2a61A|1e-04|13.5|52/142| RP:PFM:NREP 1 RP:PFM:REP 12->84,258->350|PF02163|4e-13|47.2|165/331|Peptidase_M50| HM:PFM:NREP 1 HM:PFM:REP 10->351|PF02163|2.2e-46|35.4|189/193|Peptidase_M50| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| RP:SCP:NREP 1 RP:SCP:REP 73->124|2a61A1|3e-05|13.5|52/139|a.4.5.28| HM:SCP:REP 78->124|1ku9A_|0.00016|25.5|47/151|a.4.5.36|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 33 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------1111--------------1----------1----------------1---1-1--------------1----------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----1-----1--------1------------------------------------------------11----1-----------------------------------------------------------------------------------------------------------------------------------------------111---11--------------1-1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 14.3 SQ:SECSTR ########################################################################HHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcE################################################################################################################################################################################################################################################ PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccEEEEEEcccEEEEEEEEEEccEEEccccccccccccHHHHHHHHcccccEEccccccccEEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccccccEEEEEccHHHEEEcccEEEEccccccEEEEEEccccEEEEEEEEEEEEEEEEEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //