[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56431.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:HMM:PFM   176->230 PF04480 * DUF559 0.00031 28.8 52/109  
:BLT:SWISS 114->209 Y2248_MYCTU 5e-04 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56431.1 GT:GENE ACV56431.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2897502..2898335 GB:FROM 2897502 GB:TO 2898335 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56431.1 GB:DB_XREF GI:257476111 LENGTH 277 SQ:AASEQ MPELEGIALPLHVIVSIQAARSRCGKVACHVSSAMFPRGSFVRIARNVLASSPELCFVQMASELSLPALIRLGFELCGTYGVATVGKADFRFERPFTTPARLARFLDKAANMPGTVKARKALKHLVAGSASPMETTMAMLLCLPLRMGGYALPQPRMNHAVNPRGRSRLAVDDKCYYCDLIWPNANIALEYDGREHHGTVNKMADDATRRNNLLDRGVSVLTVTTRTVRNLIELDHIARTLSRQLGFRPRYDQQAWRTKQHELHGELLGSSFMTVAM GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 114->209|Y2248_MYCTU|5e-04|30.1|83/100| SEG 216->229|rgvsvltvttrtvr| HM:PFM:NREP 1 HM:PFM:REP 176->230|PF04480|0.00031|28.8|52/109|DUF559| OP:NHOMO 17 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------D4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccccEEEEEEEcccEEccccccEEEEcccccHHHHHHHHcccEEccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEEcccHHHHEEEEEccHHHHccHHHHHHHHHHHHHHHHcccEEEEEEcHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //