[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56439.1
DDBJ      :             apurinic endonuclease Apn1
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  371/915 : Eukaryota  110/199 : Viruses  1/175   --->[See Alignment]
c.1.15
:277 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->258 1xp3A PDBj 2e-54 43.7 %
:RPS:PDB   62->263 3bzgA PDBj 3e-23 15.6 %
:RPS:SCOP  4->274 1xp3A1  c.1.15.1 * 3e-35 41.7 %
:HMM:SCOP  1->277 1qtwA_ c.1.15.1 * 1.6e-79 42.9 %
:RPS:PFM   106->232 PF01261 * AP_endonuc_2 2e-05 37.8 %
:HMM:PFM   20->234 PF01261 * AP_endonuc_2 6.9e-27 24.1 199/211  
:BLT:SWISS 1->277 END4_CLOB8 2e-92 59.1 %
:PROS 172->179|PS00730|AP_NUCLEASE_F2_2
:PROS 210->226|PS00731|AP_NUCLEASE_F2_3

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56439.1 GT:GENE ACV56439.1 GT:PRODUCT apurinic endonuclease Apn1 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2906958..2907791) GB:FROM 2906958 GB:TO 2907791 GB:DIRECTION - GB:PRODUCT apurinic endonuclease Apn1 GB:NOTE KEGG: bsu:BSU25130 endonuclease IV; TIGRFAM: apurinic endonuclease Apn1; PFAM: Xylose isomerase domain protein TIM barrel; SMART: AP endonuclease family 2 GB:PROTEIN_ID ACV56439.1 GB:DB_XREF GI:257476119 InterPro:IPR001719 InterPro:IPR012307 LENGTH 277 SQ:AASEQ MFTIGCHLSSAKGYLHMAKDAVSIDANTFQFFTRNPRGGRAKAIDPKDIAAFAAYAPEHGIERILAHAPYTLNPASDKQQTRDFALMVLAEGLGRMEETPHQLYNMHPGSAVGQPCEVAIAKIADALNQSLLPHQTTTLLLETMAGKGSEIGGTFEELAAIIAQVELESHVGVCLDTCHVWDAGYDIVGDLDGVLEEFDRVIGLDRLHAIHLNDSMNARGSHKDRHARIGEGEIGFKALAAVTNHPKLRDLPFYLETPNPDLAGYAEEIAALRRAHE GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 1->277|END4_CLOB8|2e-92|59.1|276/277| PROS 172->179|PS00730|AP_NUCLEASE_F2_2|PDOC00599| PROS 210->226|PS00731|AP_NUCLEASE_F2_3|PDOC00599| BL:PDB:NREP 1 BL:PDB:REP 4->258|1xp3A|2e-54|43.7|254/297| RP:PDB:NREP 1 RP:PDB:REP 62->263|3bzgA|3e-23|15.6|179/277| RP:PFM:NREP 1 RP:PFM:REP 106->232|PF01261|2e-05|37.8|111/200|AP_endonuc_2| HM:PFM:NREP 1 HM:PFM:REP 20->234|PF01261|6.9e-27|24.1|199/211|AP_endonuc_2| RP:SCP:NREP 1 RP:SCP:REP 4->274|1xp3A1|3e-35|41.7|271/297|c.1.15.1| HM:SCP:REP 1->277|1qtwA_|1.6e-79|42.9|275/0|c.1.15.1|1/1|Xylose isomerase-like| OP:NHOMO 510 OP:NHOMOORG 502 OP:PATTERN ------------------------11111111-1---------111111------------111--11 1111-----------1111-11111111111111111-111-------------------112-1111111----1111111-1-1111111-1----------------111111111111111111111111-111111---11----------------------------------------1111-111111111111111111111111111111111111111122111111111111111111111-1-11-----11--111-1----------------------------------------------------1-1-------1-1-1------1---11111---1---1111----1-121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111--1111-1111111111111-1-111111---------------11111--111---------------1----1-11-111---11-11111111111111111111111-111111111111111111111111111111111111111111111111111--111111111111------------------111---1----1------------------------------------------11111111111111----------------1-----------------11-121-111111111111111111111111111111-1 111111--1------1111111111-111111111111111111111111111111111111111111-1111111111111111111-11111111112--1---11-1211111------------------------------------------1---1111-----1111---------1----1--------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 277 STR:RPRED 100.0 SQ:SECSTR ccTTcccccccccHHHHHHHHHHHTccEEEEEHHHHccTccTTHHHHHHHHHHHHHHHHTccEEEEcccTTccTTcccHHHHHHHHHHHHHHHHHHHHcTTcEEEEEcccccccHHHHHHHHHHHHHHTcTcHHHHTTEEEEccccEcccccccHHHHHHHHHHHHcHHTccEEEEHHHHHHccTTccHcHHHHHHHHGGGGGcccccEEEEccccTccTccTTccTTcccccccHHHHHHHHHHcccccEEEEEccTTGGGccHHHHHHHHHHHHH PSIPRED ccEEEEEEcccccHHHHHHHHHHccccEEEEEccccHHcccccccHHHHHHHHHHHHHccccEEEEEccEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHcccccccEEEEEEHHHHHcccccHHHHHHHHHHHHHHHcHHHHcEEEEcccccccccccccccccccccccHHHHHHHcccHHHccccEEEEcccccccccHHHHHHHHHHHc //