[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56440.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->56 PF07853 * DUF1648 8.9e-10 27.7 47/51  
:HMM:PFM   67->96 PF03840 * SecG 0.00093 20.0 30/74  
:BLT:SWISS 135->215 SDPI_BACSU 2e-05 26.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56440.1 GT:GENE ACV56440.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2908232..2908882 GB:FROM 2908232 GB:TO 2908882 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: ccs:CCNA_03122 hypothetical protein GB:PROTEIN_ID ACV56440.1 GB:DB_XREF GI:257476120 LENGTH 216 SQ:AASEQ MKKGYIAVGVLFAIDVAVTAAFVAIMPDQVPVHFTGGEIDRIGSRFESFTAPALALAFGLFMMLLTRFGDEGNRATMMKLTVGMQAIFIAVTVFASLNILSHDVSDISLGAPDAGMSKIAAFVIGATLLFLGYLMPKATRNSAFGVRLPWTQKSDAAWQKGQRFGARTSIPAGILMIVCGILFDGDLAFAATMVVFAAWALISIIGSYFACKDIDA GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 135->215|SDPI_BACSU|2e-05|26.2|80/100| TM:NTM 5 TM:REGION 5->27| TM:REGION 47->69| TM:REGION 77->99| TM:REGION 116->138| TM:REGION 177->199| SEG 51->65|apalalafglfmmll| HM:PFM:NREP 2 HM:PFM:REP 10->56|PF07853|8.9e-10|27.7|47/51|DUF1648| HM:PFM:REP 67->96|PF03840|0.00093|20.0|30/74|SecG| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 216-217| PSIPRED ccccEEEHHHHHHHHHHHHHHHHHHccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccc //