[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56457.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:171 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->170 2arkA1 c.23.5.8 * 2e-14 27.9 %
:HMM:PFM   5->64 PF00258 * Flavodoxin_1 6e-08 31.7 60/143  
:PROS 5->21|PS00201|FLAVODOXIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56457.1 GT:GENE ACV56457.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2932960..2933475) GB:FROM 2932960 GB:TO 2933475 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: dds:Ddes_0527 flavodoxin family protein GB:PROTEIN_ID ACV56457.1 GB:DB_XREF GI:257476137 InterPro:IPR001226 LENGTH 171 SQ:AASEQ MSYAIVYDSRTGNTEALARAVAAALPSEGRLAFGRVDEVDRAAVAQADRVYAGFWTNRGDCGDELAEVLASLADKDVFLFGTAGFGADETYFAGVMARVAVHLPESARIVGTFMCQGRMPASVRARYAQTAEAKPEQAARMHQLIENFDEAASHPDDDDLARLREAVQAAS GT:EXON 1|1-171:0| PROS 5->21|PS00201|FLAVODOXIN|PDOC00178| SEG 16->25|alaravaaal| SEG 35->50|rvdevdraavaqadrv| HM:PFM:NREP 1 HM:PFM:REP 5->64|PF00258|6e-08|31.7|60/143|Flavodoxin_1| HM:SCP:REP 1->170|2arkA1|2e-14|27.9|147/0|c.23.5.8|1/1|Flavoproteins| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 171-172| PSIPRED cEEEEEEEccccHHHHHHHHHHHHcccccEEEEEEcccccHHHcccccEEEEEcccccccccHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc //