[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56461.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56461.1 GT:GENE ACV56461.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2935574..2935762) GB:FROM 2935574 GB:TO 2935762 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56461.1 GB:DB_XREF GI:257476141 LENGTH 62 SQ:AASEQ MVAVIDNEELPKAFPSLEDLRSGHRALTPERKAELRELIRSTTLEAPDGWGERSFKELLERG GT:EXON 1|1-62:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-46,48-48| PSIPRED cEEEEccHHHHHHcccHHHHHHcHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcc //