[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56465.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 114->232 PIP26_MAIZE 2e-04 38.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56465.1 GT:GENE ACV56465.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2938029..2938736 GB:FROM 2938029 GB:TO 2938736 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: maq:Maqu_2349 TRAP transporter, 4TM/12TM fusion protein GB:PROTEIN_ID ACV56465.1 GB:DB_XREF GI:257476145 LENGTH 235 SQ:AASEQ MKTMMLADFLALAKSLPKNVALWALLATGICLAAGNATPIILLTGFPMSHMVLMPMLLRDQRRDWVAFRQALPLSRANVVAGRYASIAVVVAGCVALGVAAYTTACIVNAVVPGLPLVRHFAVGFDAAGVVSFAAGTFALTIAMFSVLLPFMFADSHRKLASYIPFAFMLALMGWIYIFRSMNFDAFLPLVGRIVVAAQSLGGALVVGGCVTAAALALYVVSERAAVRGYATRDL GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 114->232|PIP26_MAIZE|2e-04|38.5|109/100| TM:NTM 5 TM:REGION 29->51| TM:REGION 87->109| TM:REGION 127->149| TM:REGION 160->182| TM:REGION 194->216| SEG 88->101|avvvagcvalgvaa| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,31-31,39-39,45-45,48-48,53-53,101-102,104-104,109-110,115-116,118-118,123-123,143-143,146-146,151-151,165-165,171-171,174-174,179-179,193-193| PSIPRED ccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccEEEHHHHHHHHHHHHHHHHHHHHHcccccccc //