[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56470.1
DDBJ      :             short-chain dehydrogenase/reductase SDR
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  865/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->253 2uvdA PDBj 1e-25 29.3 %
:RPS:PDB   5->254 2d1yB PDBj 7e-29 26.6 %
:RPS:SCOP  3->255 1bdbA  c.2.1.2 * 2e-33 21.3 %
:HMM:SCOP  3->250 1zemA1 c.2.1.2 * 5.6e-67 40.0 %
:RPS:PFM   8->177 PF00106 * adh_short 2e-12 32.9 %
:HMM:PFM   8->175 PF00106 * adh_short 4e-25 25.3 162/167  
:BLT:SWISS 5->250 FABG_CHLTR 1e-23 31.2 %
:PROS 145->173|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56470.1 GT:GENE ACV56470.1 GT:PRODUCT short-chain dehydrogenase/reductase SDR GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2942734..2943501) GB:FROM 2942734 GB:TO 2943501 GB:DIRECTION - GB:PRODUCT short-chain dehydrogenase/reductase SDR GB:NOTE PFAM: short-chain dehydrogenase/reductase SDR; KR domain protein; KEGG: bcm:Bcenmc03_6905 short-chain dehydrogenase/reductase SDR GB:PROTEIN_ID ACV56470.1 GB:DB_XREF GI:257476150 InterPro:IPR002198 InterPro:IPR002347 InterPro:IPR013968 LENGTH 255 SQ:AASEQ MDMGLKDKVVLITGGGGGIARGIERAFATEGAKFILTDLFPGGLEAAKEELERDFGSEVFTILANGSVEEEVRAAVEAGAEHFGGRIDVLINNAQASASGLTLVQHSEEDFDLAVRSGLYATFFYMKHAYPYLKETAGSVINFASGAGIGGNPGQSSYAAAKEGIRGMSRVAASEWGPDNINVNIVCPIVMTKALEEWREREPEMYEKNVKAIPLGRFGDAEKDVGRVCVFLASPDASFVTGDTIMVQGGSGMKP GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 5->250|FABG_CHLTR|1e-23|31.2|237/248| PROS 145->173|PS00061|ADH_SHORT|PDOC00060| SEG 14->26|gggggiargiera| SEG 68->81|veeevraaveagae| SEG 196->207|eewrerepemye| BL:PDB:NREP 1 BL:PDB:REP 5->253|2uvdA|1e-25|29.3|242/246| RP:PDB:NREP 1 RP:PDB:REP 5->254|2d1yB|7e-29|26.6|237/242| RP:PFM:NREP 1 RP:PFM:REP 8->177|PF00106|2e-12|32.9|167/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 8->175|PF00106|4e-25|25.3|162/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 3->255|1bdbA|2e-33|21.3|249/267|c.2.1.2| HM:SCP:REP 3->250|1zemA1|5.6e-67|40.0|245/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 7649 OP:NHOMOORG 1093 OP:PATTERN --1-1-2554645331-5-1---16115144622---------21-12--422-12----1-113--1 99C2I1-3449-3-CURDD-DT11JeDDDDDHSYeaMath3O5q79651751B9733411A9I187CGHK911111--1162I11211454412111--63G478S6J2C11111111111111222132111331A8869111A735872121122211422121874B3111111111111A6445661B4B99999A9A8A99AC8F978BB99A6CDEFB74444439O5333332333333327664541914315-1-464424243355223434233322222222222222344443444444412211122233357A333222242564552575323116621285112214332234512425UCCI1111164nNQ336GDKJE7888678888E-9BF98OACLRO1YNNBMJQZTVTSIN7E7CDGF9DEC8E33333333EDD535971111111111112233122112212111169Yc939OKGIaOQVXVDHGHFOOaXIIII9DiHkGfYP34DDCC4A78FDO9SU5552415731111111133C654C3431111-3221134428335354467C2212121221121111111111111214466647973A8136546469654654646351-1334611-11167664836775665656-7666656576756656655BFC542284334444443543444I4443335-16777777777771-1213121665636AF811141511111124189BD938255C6GFDF6HGRA8CD8BDDF321212112213393333335478767887745532221131555455--------1-3----------1--------------3232143464281 11--349-2-1-377DJGEIGIFPKNI775978BAA6E9D8CD9878AABHJQQ9A887987534232242231322222232354-5-885JAJ75547846BC8-566m9B9AA6313227298-62FY8-7791341824B41522381253747ALLB4MFCD86A47E8A3461G222658EDOBR887C8354 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 100.0 SQ:SECSTR ccTcTTTcEEEEETTTcHHHHHHHHHHHHTTcEEEEEEccTTHHHHHHHHTHHTTccEcEEEEccTTcHHHHHHHHHHHHHHHcTcccEEEEccccccccccTTTccHHHHHHHHHHHTHHHHHHHHHHHHHHGGGTcEEEEEccGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEcccccHHTccHHHHccHHHHHHTTcTTcccccHHHHHHHHHHHHHcGGGTTccccEEEEcTTGGGcc DISOP:02AL 255-256| PSIPRED ccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHccccccEEEEcccccccc //