[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56474.1
DDBJ      :             dephospho-CoA kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  448/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->197 2if2A PDBj 5e-16 36.5 %
:RPS:PDB   14->198 1a7jA PDBj 7e-16 11.9 %
:RPS:SCOP  6->196 1uf9A  c.37.1.1 * 1e-19 26.9 %
:HMM:SCOP  1->195 1jjvA_ c.37.1.1 * 5.1e-24 28.4 %
:RPS:PFM   6->182 PF01121 * CoaE 4e-18 37.0 %
:HMM:PFM   6->180 PF01121 * CoaE 3.1e-34 33.9 171/180  
:BLT:SWISS 1->184 COAE1_CORGL 8e-27 38.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56474.1 GT:GENE ACV56474.1 GT:PRODUCT dephospho-CoA kinase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2947945..2948544) GB:FROM 2947945 GB:TO 2948544 GB:DIRECTION - GB:PRODUCT dephospho-CoA kinase GB:NOTE KEGG: dephospho-CoA kinase ; K00859 dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase GB:PROTEIN_ID ACV56474.1 GB:DB_XREF GI:257476154 InterPro:IPR001977 LENGTH 199 SQ:AASEQ MKKLFIIGGMGAGKSTARKALVEQGLPNIDLDQVGHDVLLWDTVKSELVETFGEDILGADGEIDRRALAAKAFVSPAETRKLNRITLPRIEEAFTDRVAELEAEGHKAVVVEHSVFKNRQTSLAYDADVVIAVLAPIDLRIERAVKSGWDETDVRRRIAQQITDADRIEASDVVFNNDGTPEEMRNKVLAWWGEYSKDL GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 1->184|COAE1_CORGL|8e-27|38.3|183/200| BL:PDB:NREP 1 BL:PDB:REP 2->197|2if2A|5e-16|36.5|181/190| RP:PDB:NREP 1 RP:PDB:REP 14->198|1a7jA|7e-16|11.9|185/279| RP:PFM:NREP 1 RP:PFM:REP 6->182|PF01121|4e-18|37.0|173/179|CoaE| HM:PFM:NREP 1 HM:PFM:REP 6->180|PF01121|3.1e-34|33.9|171/180|CoaE| RP:SCP:NREP 1 RP:SCP:REP 6->196|1uf9A|1e-19|26.9|182/191|c.37.1.1| HM:SCP:REP 1->195|1jjvA_|5.1e-24|28.4|190/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 599 OP:NHOMOORG 539 OP:PATTERN -------------------------------------------------------------------- 1111-1111111111--11-1111--11111-1111-1111111---111-111-111---1111-111111111111-111-1111111111-------1111--1-1-111-111-111111-111111111111111111111---1----1111--1-----1-----------------11-----111111111111111111111111111111-1-1111111111--------------1----11111111111--111111111-111---1--11-------------111--------1-111---1111-11--1111111-1-----1-----1--1--111111111111111--111---111-------11--------------------------------------1--11------1----------11111111------------------------------------------------1----1-----11--------11111111111--------1------111-1-1111111---1--11111----------1111111--1112111--1--------1-1-11-1-1-1-11--1-1--1-1---111111111--11-111-1---11--------111111-1111111111-1111111111111111111-1--111-1111111111-11111111111111-111111111111--------------1--1111111-----1---11111111111-1111111111111-11----------1------------------1--111------1-----11------------------------------------------1---1-1 ----111------1------------------------------------------------11111--11111-1-1---1111----111-111----1-1111----322232-1--121111-3-8B5-21--2-13-232-11112--22122222112222222-1121------1-111113-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 100.0 SQ:SECSTR cEEEEEEccTTccHHHHHHHHHHHTccEEGGGccccHHHHHHHHHHHHHHTcTTccTTcGGGccHHHHHHHHHHHHHHcccEEccccccccccTTcccccEEccccccEEEEEEcccccccccGGGccEEEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHHHHGGTccEEEEEEEccccccGGGccccccGGGEc DISOP:02AL 199-200| PSIPRED cEEEEEEccccccHHHHHHHHHHccccEEEHHHHHHHHHcccHHHHHHHHHHcccEEcccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHcc //