[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56479.1
DDBJ      :             ferric uptake regulator, Fur family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  346/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:138 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->132 2fe3B PDBj 3e-22 36.4 %
:RPS:PDB   14->69 2co5B PDBj 2e-04 12.7 %
:RPS:SCOP  4->129 1mzbA  a.4.5.42 * 1e-18 21.4 %
:HMM:SCOP  2->131 1mzbA_ a.4.5.42 * 1.1e-29 33.8 %
:RPS:PFM   8->123 PF01475 * FUR 9e-17 33.6 %
:HMM:PFM   10->124 PF01475 * FUR 8.3e-29 29.6 115/120  
:BLT:SWISS 12->132 PERR_BACSU 9e-22 36.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56479.1 GT:GENE ACV56479.1 GT:PRODUCT ferric uptake regulator, Fur family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2954828..2955244) GB:FROM 2954828 GB:TO 2955244 GB:DIRECTION - GB:PRODUCT ferric uptake regulator, Fur family GB:NOTE PFAM: ferric-uptake regulator; KEGG: dps:DP2867 ferric uptake regulatory protein GB:PROTEIN_ID ACV56479.1 GB:DB_XREF GI:257476159 InterPro:IPR002481 LENGTH 138 SQ:AASEQ MATEKAERATTRNTIQRALVLEAVQSLHNHPTSADVYEVVRARHPNISRATVYRNLGVLANRGEVLRVEVPNGADRYDFLNKPHYHAKCRICGGVFDIDMPYQDDIVSRVSDAHGFTIEHHEIIFDGVCAHCKASAEN GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 12->132|PERR_BACSU|9e-22|36.4|121/145| BL:PDB:NREP 1 BL:PDB:REP 12->132|2fe3B|3e-22|36.4|121/143| RP:PDB:NREP 1 RP:PDB:REP 14->69|2co5B|2e-04|12.7|55/94| RP:PFM:NREP 1 RP:PFM:REP 8->123|PF01475|9e-17|33.6|116/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 10->124|PF01475|8.3e-29|29.6|115/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 4->129|1mzbA|1e-18|21.4|126/133|a.4.5.42| HM:SCP:REP 2->131|1mzbA_|1.1e-29|33.8|130/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 589 OP:NHOMOORG 350 OP:PATTERN --------------------------------------------------21---------------- 121111-1111-1-22222-2211242222223222-233122321212---1-13-1--333-23234321---111121121-311--11---------------1-------------------122111112-11--44411221111--1221-11--111111--------------22-33111122222222222222222223311222322221222222224122222222222222211222-1-11-1---111111111------1111111111-----------1111111111111111111111123122222222232312552222221232211-22312121133342-1111------------------------------------------------------------------------------------------------------------------------------111-------------------------1-1------1-1--2----1----------------------131-11122332241212223112----112412222222222----------2-22----1---1-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1111211------------------------------------22-12121111-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 92.8 SQ:SECSTR #####cTTTHHccHHHHHHHHHHHTTcTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEcccccccEEEEccccEEEEEETTTccEEEccccccHHHHHHHHHHHcccccccEEEEEEccHHHc##### PSIPRED cHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEccccccEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHHcccc //