[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56520.1
DDBJ      :             ABC-type phosphate transport system periplasmic component-like protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  270/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:307 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   49->180,197->303 1twyF PDBj 3e-17 36.5 %
:RPS:PDB   49->158,198->306 2capA PDBj 7e-13 10.1 %
:RPS:PDB   132->182 3cg1A PDBj 3e-04 15.7 %
:RPS:SCOP  50->178,197->300 1twyA  c.94.1.1 * 1e-20 33.6 %
:HMM:SCOP  46->184 1pc3A_ c.94.1.1 * 7.8e-27 31.7 %
:HMM:SCOP  188->303 1pc3A_ c.94.1.1 * 4.1e-28 40.5 %
:HMM:PFM   192->279 PF03466 * LysR_substrate 7.2e-10 20.9 86/209  
:BLT:SWISS 50->303 PSTS2_STRA5 7e-81 59.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56520.1 GT:GENE ACV56520.1 GT:PRODUCT ABC-type phosphate transport system periplasmic component-like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3001470..3002393) GB:FROM 3001470 GB:TO 3002393 GB:DIRECTION - GB:PRODUCT ABC-type phosphate transport system periplasmic component-like protein GB:NOTE KEGG: swp:swp_5140 phosphate ABC transporter, periplasmic phosphate-binding protein GB:PROTEIN_ID ACV56520.1 GB:DB_XREF GI:257476200 LENGTH 307 SQ:AASEQ MKKRLAMAVSAAVLALGLFGLFGCASGNGDGASGATDGGASASTSPSGEVSVYSREDGSGTRGAFIELFGIEEKDANGDKVDLTTPTAAITNSTSVMMTSVAGDANAIGYISLGSLNNTVKALSIDGAEATAENVKSGTYKVARPFNIVTKDGVSDVAQDFIDYIMSSDGQKVVEENGCISVADNAGSYKASGKSGKIVIAGSSSVTPVMEKLAEAYKALNPDVAIEVNQSDSTTGVNMATEGTCDIGMVSRELKDSESGVKATVIAQDGIAVIVNPDASIDELTSDQVKGIYTGELTTWEDVVPSA GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 50->303|PSTS2_STRA5|7e-81|59.7|253/293| TM:NTM 1 TM:REGION 5->25| SEG 5->48|lamavsaavlalglfglfgcasgngdgasgatdggasastspsg| BL:PDB:NREP 1 BL:PDB:REP 49->180,197->303|1twyF|3e-17|36.5|231/241| RP:PDB:NREP 2 RP:PDB:REP 49->158,198->306|2capA|7e-13|10.1|214/376| RP:PDB:REP 132->182|3cg1A|3e-04|15.7|51/293| HM:PFM:NREP 1 HM:PFM:REP 192->279|PF03466|7.2e-10|20.9|86/209|LysR_substrate| RP:SCP:NREP 1 RP:SCP:REP 50->178,197->300|1twyA|1e-20|33.6|232/249|c.94.1.1| HM:SCP:REP 46->184|1pc3A_|7.8e-27|31.7|139/0|c.94.1.1|1/2|Periplasmic binding protein-like II| HM:SCP:REP 188->303|1pc3A_|4.1e-28|40.5|116/0|c.94.1.1|2/2|Periplasmic binding protein-like II| OP:NHOMO 380 OP:NHOMOORG 291 OP:PATTERN -------------------------11-----112--2211121111221112--------------- -------------------------------------------------------------------------------111------111111--------1----------------------22-221222-1---121111-1211--1---------------------------------------111111112111111111-1111211121-1--11111111-11111111111111-111-2---22-11-112112221-212---11112221--22222222222111-1111111111121111111212111212222121-111-2222111111111--321-1-1111121----1--------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------1--------------1211--12112211-1-2--12311111-24---------------------1-----1111------2-------1-----111-1----211-------------------------------------------------------------------------------------------------------------------------------------------1121-1111--------------12222222212222----------------1111----1111-111--1-------------------------1111111111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 84.4 SQ:SECSTR ################################################ccEEEEEccccHHHHHHHHHHHHHcccccccTTcTTcEEEcHHHHHHHHHHcTTccccEEccccHHHHcccGGGGGccccccTTTccEEccEEETTEEEccccccTHHHHHHHHHHHHHHHcHHHHHHTTcEEccHHHcccccHHHHcEccEEEccTTHHHHTcTTTccTTccccEEHHHHHHTcGGGTcccTTccccEEEEcccccHHHccEEEEEEEEEEccccccccccccEEcHHHHHHHHHTccccGGGcTTcT PSIPRED cccHHHHHHHHHHHHHHHccccccccccccEEEHHHcccccccccccccEEEEEccccccHHHHHHHHHccccccccccccccccccEEEEccHHHHHHHHHcccccEEEEEHHHHcccccEEEEccccccHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccEEEccccccccccccEEEEEEEEEEEEEEccccccccccHHHHHHHHccccccHHHccccc //