[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56537.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.9
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   31->193 1mldA PDBj 3e-06 29.2 %
:HMM:SCOP  28->131 1sr3A_ b.40.9.1 * 5.4e-11 25.0 %
:HMM:SCOP  128->221 1j6qA_ b.40.9.1 * 1.5e-09 22.6 %
:RPS:PFM   49->127 PF03100 * CcmE 5e-05 32.0 %
:HMM:PFM   3->128 PF03100 * CcmE 3.6e-12 23.8 122/131  
:HMM:PFM   146->217 PF03100 * CcmE 6.6e-09 24.3 70/131  
:BLT:SWISS 40->127 CCME_HAHCH 3e-05 30.8 %
:BLT:SWISS 152->217 CCME_POLNS 8e-07 37.5 %
:TM
:REPEAT 2|31->119|131->217
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56537.1 GT:GENE ACV56537.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3023231..3023896) GB:FROM 3023231 GB:TO 3023896 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: hch:HCH_04365 cytochrome c-type biogenesis protein CcmE GB:PROTEIN_ID ACV56537.1 GB:DB_XREF GI:257476217 LENGTH 221 SQ:AASEQ MNAKTKRRMVVVTGIIVIVLVVILAVVGGTSSAKTVSVAEAATGSYADQKIQVSGNVVENSFATEGNVLTFDIYDPNGDITQQLRVRFEGGVSATFGNDVTAICTGKVGEDGVLNASELVTKCPSKYENATNALTVSQLTGYGDEVVDKPVKVAGAVKDGTLKAAGEGDRFVLVDPENGEELAVEFNDAISEEVKDGSSLVLTGSMNAQGKFSATEVALEG GT:EXON 1|1-221:0| BL:SWS:NREP 2 BL:SWS:REP 40->127|CCME_HAHCH|3e-05|30.8|84/149| BL:SWS:REP 152->217|CCME_POLNS|8e-07|37.5|64/144| TM:NTM 1 TM:REGION 9->31| NREPEAT 1 REPEAT 2|31->119|131->217| SEG 10->30|vvvtgiivivlvvilavvggt| BL:PDB:NREP 1 BL:PDB:REP 31->193|1mldA|3e-06|29.2|161/313| RP:PFM:NREP 1 RP:PFM:REP 49->127|PF03100|5e-05|32.0|75/131|CcmE| HM:PFM:NREP 2 HM:PFM:REP 3->128|PF03100|3.6e-12|23.8|122/131|CcmE| HM:PFM:REP 146->217|PF03100|6.6e-09|24.3|70/131|CcmE| GO:PFM:NREP 3 GO:PFM GO:0005886|"GO:plasma membrane"|PF03100|IPR004329| GO:PFM GO:0017003|"GO:protein-heme linkage"|PF03100|IPR004329| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03100|IPR004329| HM:SCP:REP 28->131|1sr3A_|5.4e-11|25.0|100/0|b.40.9.1|1/2|Heme chaperone CcmE| HM:SCP:REP 128->221|1j6qA_|1.5e-09|22.6|93/0|b.40.9.1|2/2|Heme chaperone CcmE| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 74.7 SQ:SECSTR ##############################HHHHHHHHHHHHHHHHcTcEEEEccccHHHHHHHHHHHHHTTcccTTcEccHHHHHHHHHHHHHHTTccGGGccccEEEcccGGGEEEcGGGccccccccHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHTcTTcEEEEEEEccccc########################## PSIPRED ccccccEEEEEEEHHHHHHHHHHHHEEEcccccEEEEEEEcccccccccEEEEEEEEEEccccccccEEEEEEEccccccEEEEEEEEEccccccccccEEEEEEEEEEcccEEEHHHHHHcccccccccccEEEEEEEccccccccccEEEEEEEEEccEEEEcccEEEEEEEEcccccEEEEEEcccccHHHHcccEEEEEEEEccccEEEEEEEEEcc //