[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56546.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->74 1b0nA PDBj 4e-05 18.3 %
:RPS:SCOP  5->74 2o38A1  a.35.1.13 * 2e-05 23.9 %
:HMM:PFM   6->47 PF01381 * HTH_3 8.2e-09 27.5 40/55  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56546.1 GT:GENE ACV56546.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3034166..3034390 GB:FROM 3034166 GB:TO 3034390 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56546.1 GB:DB_XREF GI:257476226 LENGTH 74 SQ:AASEQ MLYPNLEAEMKRFGVDQRDIAQTTGKHVTTISDWMNGKVDSAFPVKQAIKVQRELFPTLPIEYLFDEQPIQRAS GT:EXON 1|1-74:0| RP:PDB:NREP 1 RP:PDB:REP 1->74|1b0nA|4e-05|18.3|71/103| HM:PFM:NREP 1 HM:PFM:REP 6->47|PF01381|8.2e-09|27.5|40/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 5->74|2o38A1|2e-05|23.9|67/89|a.35.1.13| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcccccccHHHHHHHHHHHTTTccHHHHHccTTccccH DISOP:02AL 31-31,34-34,39-39,53-53,59-60,62-62,66-67,73-75| PSIPRED cccccHHHHHHHHcccHHHHHHHHccccEEHHHHHcccccccccHHHHHHHHHHHcccccHHHHHccccHHHcc //