[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56559.1
DDBJ      :             DNA methylase N-4/N-6 domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.66.1
:237 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->197 1g60B PDBj 1e-07 28.0 %
:RPS:PDB   5->197 1eg2A PDBj 4e-07 16.1 %
:RPS:SCOP  6->197 1g60A  c.66.1.11 * 9e-24 26.3 %
:HMM:SCOP  1->215 1g60A_ c.66.1.11 * 6.1e-39 26.8 %
:RPS:PFM   151->197 PF01555 * N6_N4_Mtase 2e-09 51.1 %
:HMM:PFM   25->210 PF01555 * N6_N4_Mtase 3.7e-28 28.6 185/231  
:BLT:SWISS 6->197 MTC1_CAUCR 2e-12 30.9 %
:PROS 26->32|PS00092|N6_MTASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56559.1 GT:GENE ACV56559.1 GT:PRODUCT DNA methylase N-4/N-6 domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3040471..3041184 GB:FROM 3040471 GB:TO 3041184 GB:DIRECTION + GB:PRODUCT DNA methylase N-4/N-6 domain protein GB:NOTE PFAM: DNA methylase N-4/N-6 domain protein; KEGG: bch:Bcen2424_6933 DNA methylase N-4/N-6 domain-containing protein GB:PROTEIN_ID ACV56559.1 GB:DB_XREF GI:257476239 InterPro:IPR001091 InterPro:IPR002052 InterPro:IPR002295 InterPro:IPR002941 LENGTH 237 SQ:AASEQ MPEFEVIAGDMFDVIGRVEPASCRCVLIDPPYMIGTQSVHRDNMIDPWADLMNGARFYREVIDAVRPKLTKDGAMWLFMNWRGLPGIYKASCDAKWLPASCMVWSKDWPGTGDPLRASHELCLLYTCDGFKRPNAKTLDVQTFKLVPTAHRVHSAQKPVPLLRMMLDFTTARGDKVLDCFCGSGSTGVAAVSMGRRFVGIEANAAIAEVARRRIEGEASQGQLFVTSEEGKRGNIER GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 6->197|MTC1_CAUCR|2e-12|30.9|191/358| PROS 26->32|PS00092|N6_MTASE|PDOC00087| SEG 198->218|vgieanaaiaevarrriegea| BL:PDB:NREP 1 BL:PDB:REP 12->197|1g60B|1e-07|28.0|175/228| RP:PDB:NREP 1 RP:PDB:REP 5->197|1eg2A|4e-07|16.1|193/270| RP:PFM:NREP 1 RP:PFM:REP 151->197|PF01555|2e-09|51.1|47/218|N6_N4_Mtase| HM:PFM:NREP 1 HM:PFM:REP 25->210|PF01555|3.7e-28|28.6|185/231|N6_N4_Mtase| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01555|IPR002941| GO:PFM GO:0006306|"GO:DNA methylation"|PF01555|IPR002941| GO:PFM GO:0008170|"GO:N-methyltransferase activity"|PF01555|IPR002941| RP:SCP:NREP 1 RP:SCP:REP 6->197|1g60A|9e-24|26.3|186/239|c.66.1.11| HM:SCP:REP 1->215|1g60A_|6.1e-39|26.8|209/256|c.66.1.11|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 43 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1---11-----------------------------------------------------------------111---1----------------------------1---------------------------1-31111-------------1-----------------------------------11----------11--2--------------------------------------------------------------------1-12--------------------------------------------------------1----------------------------------------11--1--2--1--2------1------------------------1------1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 82.7 SQ:SECSTR #ccEEEEEccHHHHHHTccTTcEEEEEEccccccEEEEEEEEcccccccTTcccHHHHHHHHHHHcccEEEEEEEEEccccccccccccccEEEEEEEEccTTcccccGGGcccccHHHHHHHHTcTTccHHHHHHccccccEEEccccccccTTcccHHHHHHHHHHHccTTcEEEETTcTTcHHHHHHHHHTcEE######################################## PSIPRED ccccEEEEccHHHHHHHcccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHcccEEccEEEEEEccccccccccccccEEEEEEEccccccccccccEEEEEccccccccccccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHccccccEEEEEEcccEEEccc //