[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56572.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->57 PF06791 * TMP_2 0.0002 24.1 54/210  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56572.1 GT:GENE ACV56572.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3045926..3046207 GB:FROM 3045926 GB:TO 3046207 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56572.1 GB:DB_XREF GI:257476252 LENGTH 93 SQ:AASEQ MSDSLEDTVRRVSQASKCSSVDIAAFAGELARIGETAKEAFERMAESLAEIRRIADEQTKPEVFVVDGTPVQHAPRVPPKHVCGEHTDPEVLA GT:EXON 1|1-93:0| HM:PFM:NREP 1 HM:PFM:REP 3->57|PF06791|0.0002|24.1|54/210|TMP_2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,93-94| PSIPRED ccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHccccccHHHcc //