[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56577.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   65->123 PF06810 * Phage_GP20 0.00027 25.4 59/156  
:HMM:PFM   134->158 PF06810 * Phage_GP20 0.00098 37.5 24/156  
:BLT:SWISS 58->153 IFB1_CAEEL 1e-05 30.1 %
:COIL
:REPEAT 2|105->138|139->170
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56577.1 GT:GENE ACV56577.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3051254..3051796 GB:FROM 3051254 GB:TO 3051796 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: hypothetical protein GB:PROTEIN_ID ACV56577.1 GB:DB_XREF GI:257476257 LENGTH 180 SQ:AASEQ MDPENEDKAGEEAAAEPQKGATEATEATDPKPAAEGAEGAAEDGEELTDEHGHPAISKGKYERDIATKDAKIAELEKQIGEAAKTEAGRAALEKKIAELKDDQAEIRTDYELKLAGCTDEKKFKAAKKLVGDYEGDVDKLKADYPYLFAEDKKKGSTGKKPEGAGGSDIDDKLDRAFGLK GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 58->153|IFB1_CAEEL|1e-05|30.1|93/589| COIL:NAA 31 COIL:NSEG 1 COIL:REGION 72->102| NREPEAT 1 REPEAT 2|105->138|139->170| SEG 33->46|aaegaegaaedgee| HM:PFM:NREP 2 HM:PFM:REP 65->123|PF06810|0.00027|25.4|59/156|Phage_GP20| HM:PFM:REP 134->158|PF06810|0.00098|37.5|24/156|Phage_GP20| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 110-126,137-137,143-143,151-151,165-165| PSIPRED cccccHHHHHHHHHHHHHcccHHHHHccccccHHHHcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccHHHHHcccccEEEcccccccccccccccccccHHHHHHHHHccc //