[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56581.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->108 PF10665 * Phage_Gp9 2e-16 41.3 %
:HMM:PFM   25->109 PF10665 * Phage_Gp9 2.6e-14 29.4 85/114  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56581.1 GT:GENE ACV56581.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3053229..3053558 GB:FROM 3053229 GB:TO 3053558 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56581.1 GB:DB_XREF GI:257476261 LENGTH 109 SQ:AASEQ MLQIPKRALPSTAAVRVPLEGDYGGEFAEPVAIGHVRYEKAAGIRRTDYQLQDGTTGIVFIDAVNSEGAFEVPASSMVSIDGAPEVCVNACHPREQFAGRVHHWELEVR GT:EXON 1|1-109:0| RP:PFM:NREP 1 RP:PFM:REP 4->108|PF10665|2e-16|41.3|104/107|Phage_Gp9| HM:PFM:NREP 1 HM:PFM:REP 25->109|PF10665|2.6e-14|29.4|85/114|Phage_Gp9| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 67-67,73-74,76-76,81-82,87-87| PSIPRED cccccccccccccEEEEEEcccccccccccEEEEEEEEEcccccEEcEEEEccccEEEEEEEEEcccccEEcccccEEEEccccHHHEcccccHHHHccEEEEEEEEEc //