[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56585.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->73 PF02812 * ELFV_dehydrog_N 0.00047 31.2 32/131  
:HMM:PFM   118->148 PF08679 * DsrD 0.00094 35.5 31/67  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56585.1 GT:GENE ACV56585.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3055087..3055545 GB:FROM 3055087 GB:TO 3055545 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56585.1 GB:DB_XREF GI:257476265 LENGTH 152 SQ:AASEQ MAKIIAFGKLFEPLDIELGDETVHARIDLRDSSVNKNWELLRSSREKMEAIQEAGKALESACGPEADKIAKDMADLMRPAICGAIGEQSYLEILVACGDGEPVQPEEANMVMALVFSEIEVAIIDRIKAFKDHKAAHYLKEIANAQPEPHKA GT:EXON 1|1-152:0| HM:PFM:NREP 2 HM:PFM:REP 42->73|PF02812|0.00047|31.2|32/131|ELFV_dehydrog_N| HM:PFM:REP 118->148|PF08679|0.00094|35.5|31/67|DsrD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 59-59,67-67,73-74,76-76,81-81,87-87,95-95,109-109,115-115,118-118,123-123| PSIPRED ccHHHHHHHccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //