[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56595.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56595.1 GT:GENE ACV56595.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3065736..3065954 GB:FROM 3065736 GB:TO 3065954 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56595.1 GB:DB_XREF GI:257476275 LENGTH 72 SQ:AASEQ MERTEIEGAINAYKNLLQQTDYMAIKHADGALTPEEYGPMRAKREEWREAINQCEAQLATLDEQEPAEQGAI GT:EXON 1|1-72:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,45-45,48-48,53-53,72-73| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccc //