[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56600.1
DDBJ      :             CHAP domain containing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
d.2.1d.3.1
:279 amino acids
:PSIPRED
:RPS:SCOP  26->142 2io7A2  d.3.1.15 * 1e-06 11.1 %
:RPS:SCOP  225->249 2ikbA1  d.2.1.9 * 5e-04 40.0 %
:HMM:SCOP  15->150 2evrA2 d.3.1.16 * 2.5e-06 22.0 %
:HMM:PFM   36->135 PF05257 * CHAP 2.8e-11 27.0 100/125  
:HMM:PFM   224->248 PF01471 * PG_binding_1 4.2e-06 36.0 25/57  
:BLT:SWISS 33->131 YGL4_BACST 5e-05 30.5 %
:BLT:SWISS 109->262 LYS_CLOAB 8e-06 32.9 %
:REPEAT 2|149->212|217->279

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56600.1 GT:GENE ACV56600.1 GT:PRODUCT CHAP domain containing protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3067373..3068212 GB:FROM 3067373 GB:TO 3068212 GB:DIRECTION + GB:PRODUCT CHAP domain containing protein GB:NOTE PFAM: CHAP domain containing protein; KEGG: sus:Acid_5388 peptidoglycan binding domain- containing protein GB:PROTEIN_ID ACV56600.1 GB:DB_XREF GI:257476280 InterPro:IPR007921 LENGTH 279 SQ:AASEQ MANSAADVIRIAAAEVGYSRWSDPEQGTKYGRWYAEKTGSGYYGTNGVPYCAMFVSWVMAQAGARCEGIPGAYCPWILNAGRKAGKLVSAANAKPGDVVLFDWEGDGTSDHVGFVERNSGVLHTIEGNTNNGAVARRTRSYGTVCGVIRPDYDGTTASAPENGVGALEVDGVWGPATTRAVQAALGTTQDGIVSDQYAGYRAGNPGLSSASWEWHSRTSLGSDMVRALQRKIGATVDGVAGPKTFRALQTCLGTTQDGRISNPSTCVKALQQRLNAGTF GT:EXON 1|1-279:0| BL:SWS:NREP 2 BL:SWS:REP 33->131|YGL4_BACST|5e-05|30.5|95/301| BL:SWS:REP 109->262|LYS_CLOAB|8e-06|32.9|143/324| NREPEAT 1 REPEAT 2|149->212|217->279| HM:PFM:NREP 2 HM:PFM:REP 36->135|PF05257|2.8e-11|27.0|100/125|CHAP| HM:PFM:REP 224->248|PF01471|4.2e-06|36.0|25/57|PG_binding_1| RP:SCP:NREP 2 RP:SCP:REP 26->142|2io7A2|1e-06|11.1|117/177|d.3.1.15| RP:SCP:REP 225->249|2ikbA1|5e-04|40.0|25/163|d.2.1.9| HM:SCP:REP 15->150|2evrA2|2.5e-06|22.0|123/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 18 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------1---------------------------------1-----------------------------------------------------------------------1----------1------------------------------------------------------------------1---------------------------------------------321-------1----------------------1-----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------111---1-------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHcccccccccccccEEEcccEEccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEccccccccEEEEcccccccccEEEEEEEcccEEEEEEccccccEEEEccccccEEEEEEEccccccccccccccccEEEEEEEEccHHHHHHHHHHccccccccHHHHcccccccccccEEEEcccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccc //