[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56613.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.226.1
:114 amino acids
:PSIPRED
:RPS:SCOP  21->86 1ln0A  d.226.1.1 * 2e-05 18.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56613.1 GT:GENE ACV56613.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3083610..3083954 GB:FROM 3083610 GB:TO 3083954 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: pzu:PHZ_c2306 hypothetical protein GB:PROTEIN_ID ACV56613.1 GB:DB_XREF GI:257476293 LENGTH 114 SQ:AASEQ MQTDRRKELRDAYKSRRPDMGVVELRCTATGQHFLGITRDAAKELNSLRAKLNGGGHPNRPLQQLWSEHGENGFDFHVADTLEYENPEDVSADDLQALRDLLLAEDPEACKIWK GT:EXON 1|1-114:0| SEG 92->104|addlqalrdllla| RP:SCP:NREP 1 RP:SCP:REP 21->86|1ln0A|2e-05|18.8|64/92|d.226.1.1| OP:NHOMO 18 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------11----1----1----22------------------1111---------------1-----------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHcccccEEEEEEEccccEEEEcccHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHHHHccHHHHHccc //