[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56617.1
DDBJ      :             drug resistance transporter, EmrB/QacA subfamily
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  581/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->189 2gfpA PDBj 3e-06 17.6 %
:RPS:SCOP  27->188 1pw4A  f.38.1.1 * 6e-13 10.6 %
:HMM:SCOP  1->484 1pw4A_ f.38.1.1 * 6.2e-71 23.7 %
:RPS:PFM   48->188 PF07690 * MFS_1 2e-10 29.1 %
:HMM:PFM   41->432 PF07690 * MFS_1 1.5e-50 24.4 340/353  
:BLT:SWISS 35->439 YHCA_BACSU 3e-58 37.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56617.1 GT:GENE ACV56617.1 GT:PRODUCT drug resistance transporter, EmrB/QacA subfamily GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3085847..3087304) GB:FROM 3085847 GB:TO 3087304 GB:DIRECTION - GB:PRODUCT drug resistance transporter, EmrB/QacA subfamily GB:NOTE TIGRFAM: drug resistance transporter, EmrB/QacA subfamily; PFAM: major facilitator superfamily MFS_1; KEGG: bsu:BSU03840 hypothetical protein GB:PROTEIN_ID ACV56617.1 GB:DB_XREF GI:257476297 InterPro:IPR001411 InterPro:IPR004638 InterPro:IPR007114 InterPro:IPR011701 LENGTH 485 SQ:AASEQ MESAQAIERERNYGSAGDTAQGVSDGLPKRQRTIVLAVMMSGTTAACISQSMMIAALPTIMHEYSVSASLGQLLTTSYIFTLGLISAMTAYLVHRVDSKKLFIAAMVCFVAGCAAALVAPNYPLLLASRLLQAGGAGIALPLIQVVALSVYPKSEYGRAMGLVGLIIGFAPAIGPTVSGFLIDFWGWRSVFVILGAVSAVVVVLSLFVLSDVVKREGSRERFDVPSGLLYTLGFCGIMLGTTVMESDAAFDPVSLAALAGGALALFVFARRQARIEQSLLKLSCFRNRTFAIATVLVMMSQMAFMVGSIMVPLFVQDVQGGSATVSGLTILPGAVLLGFLNPVTGRLLDRYGPRPLVAVGCAVLAAGTLAFAACDAGTPEWAITVLYGVRTVGVACLMMPMTAHACAALSLEDIAQGTAIITSFRQIFGALSSSALITVMALASSNELGIDVGGFALSFEVQAAVIVVGFVVGMAFLPRPQRKTR GT:EXON 1|1-485:0| BL:SWS:NREP 1 BL:SWS:REP 35->439|YHCA_BACSU|3e-58|37.7|403/532| TM:NTM 14 TM:REGION 35->57| TM:REGION 70->92| TM:REGION 101->123| TM:REGION 128->150| TM:REGION 159->181| TM:REGION 190->212| TM:REGION 223->245| TM:REGION 248->269| TM:REGION 292->314| TM:REGION 323->345| TM:REGION 353->375| TM:REGION 386->408| TM:REGION 420->442| TM:REGION 453->475| SEG 190->213|vfvilgavsavvvvlslfvlsdvv| SEG 255->265|laalaggalal| SEG 356->377|lvavgcavlaagtlafaacdag| SEG 461->476|vqaavivvgfvvgmaf| BL:PDB:NREP 1 BL:PDB:REP 48->189|2gfpA|3e-06|17.6|142/375| RP:PFM:NREP 1 RP:PFM:REP 48->188|PF07690|2e-10|29.1|141/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 41->432|PF07690|1.5e-50|24.4|340/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 27->188|1pw4A|6e-13|10.6|160/434|f.38.1.1| HM:SCP:REP 1->484|1pw4A_|6.2e-71|23.7|414/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1920 OP:NHOMOORG 646 OP:PATTERN ------2----------------1--------2121-------142131-111-------111----- 2131A12455431143211-13--441111125546579515473573132-3333-2--24211368A713333475126211211122---2-------1---5-3-1--------------1-11----11--1111211142-----------------------2--------------11----15-888888678388757662985867712335314344455D344444444444444544554561BC162-29766AA436857544222-1-1122-----------11111111111111-----1--1---86---11--21122771332-----3--2-333321--2321--------5112----1215762-12311211221222223-11411514141-73327537663534-1-13-1111-1-1111111131111212------------------------1------231343336CEECEC89898BBBB888859I9A5779--334-122241323124-----221122222---112-1311-1--21111-2-112121111-11-12------------1---------11-33221-21--11--1111---1111-1--111--1----------24453532222222222-2222222222222222222585233433213223222323233522122211-533333333333----323321111--23-----2--11------11112-11131-21214543132311244-1---11-1-3112-----111--33222222221-----------------------------------------------------------11- -------------11111-21111311--1---1--1-------112123432221311233--1----1-------------------11-1-21---33---------------------------------------------------------1--------------------7-------1-3--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 29.3 SQ:SECSTR ###############################################HHHHHHHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHH######################################################################################################################################################################################################################################################################################################## DISOP:02AL 484-486| PSIPRED cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccc //