[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56635.1
DDBJ      :             PilT protein domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:151 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   3->130 2bsqB PDBj 1e-06 14.5 %
:RPS:SCOP  3->130 2bsqA1  c.120.1.1 * 2e-07 13.9 %
:HMM:SCOP  1->152 1w8iA_ c.120.1.1 * 2.4e-12 24.7 %
:HMM:PFM   4->124 PF01850 * PIN 2.8e-05 18.6 113/126  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56635.1 GT:GENE ACV56635.1 GT:PRODUCT PilT protein domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3110822..3111277) GB:FROM 3110822 GB:TO 3111277 GB:DIRECTION - GB:PRODUCT PilT protein domain protein GB:NOTE KEGG: glo:Glov_1224 PilT protein domain protein GB:PROTEIN_ID ACV56635.1 GB:DB_XREF GI:257476315 LENGTH 151 SQ:AASEQ MRLMLDSNIVIDYIKMREPFYASARKLVMLGFLAEHELWFSSAQANDVFYTLTGGGRPSQAAQLKQDLKKMRQGMRICGVNEVQFDAALDSSWVDLEDACVYQCALRLKADAIITRNQKDFEKSTIKVFDCDELFAYLAEEKGFTYEEIPW GT:EXON 1|1-151:0| RP:PDB:NREP 1 RP:PDB:REP 3->130|2bsqB|1e-06|14.5|124/140| HM:PFM:NREP 1 HM:PFM:REP 4->124|PF01850|2.8e-05|18.6|113/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 3->130|2bsqA1|2e-07|13.9|122/138|c.120.1.1| HM:SCP:REP 1->152|1w8iA_|2.4e-12|24.7|146/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 22 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-32---------------------1------------------------------------------1-2--------------2-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--11------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 94.0 SQ:SECSTR #EEEEcHHHHTcTTcccccHHHHHHHTTcHHTccGGGEEEEHHHHHHHHHHHHTccccHHHHHHHHHHHHTTGTTcEEcccHHHHHHHHHTTTccccHHHHHHHHHHHHTTcEEcccHHHHHHTTccEEcccHHHHHHHHHTT######## PSIPRED cEEEEEEcEEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHccccccHHHHHHHHHHHHcccEEEEEccHHHccccccEEEcHHHHHHHHHHHccccHHcccc //