[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56666.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  329/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:382 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  30->263 1pv6A  f.38.1.2 * 3e-09 17.7 %
:HMM:SCOP  1->380 1pw4A_ f.38.1.1 * 2.4e-56 25.7 %
:RPS:PFM   23->262 PF07690 * MFS_1 8e-11 27.6 %
:HMM:PFM   18->339 PF07690 * MFS_1 2.8e-43 25.7 319/353  
:BLT:SWISS 6->330 NART_STAES 1e-88 47.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56666.1 GT:GENE ACV56666.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3146808..3147956 GB:FROM 3146808 GB:TO 3147956 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:NOTE PFAM: major facilitator superfamily MFS_1; KEGG: bcy:Bcer98_3390 major facilitator transporter GB:PROTEIN_ID ACV56666.1 GB:DB_XREF GI:257476346 InterPro:IPR007114 InterPro:IPR011701 LENGTH 382 SQ:AASEQ MRRRFQLPLQTADLIAGFMVWVILSSLLPYIKQDVYIPPDQIALVTAIPVVLGSVLRVPFGYCANLFGARAVFLASFIVLVVPVWFLSEATTYQGLLIGGTFLGIAGAVFSVGVTSLPKYYPKERHGFVNGVYGFGNMGTALTTWLAPVAAVAFGWRMAVKLYLVLLAAFIVLNFVLGDRDEPRVKTPVMEQLRAVWSDARLWFLSLFYFVTFGAFVALTVYLPNFLTSHYGMDGVSAGVATSVFIVAAAAIRVLGGWLGDRFDCYRLLALVFAGLAAGAAVLATAPGLPVYLAGIYLVSIACGIGNGVVFKLVPAYFTKQAGIANGIVAMMGGLGGFFPPLVLSASTLLFSTSVPGFAAFGAFALACLAISLVMRRKTRSS GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 6->330|NART_STAES|1e-88|47.4|325/387| TM:NTM 11 TM:REGION 10->32| TM:REGION 40->62| TM:REGION 66->88| TM:REGION 95->117| TM:REGION 150->172| TM:REGION 204->226| TM:REGION 235->257| TM:REGION 265->287| TM:REGION 294->316| TM:REGION 326->348| TM:REGION 354->375| SEG 268->291|llalvfaglaagaavlatapglpv| SEG 331->342|mmgglggffppl| SEG 357->370|gfaafgafalacla| RP:PFM:NREP 1 RP:PFM:REP 23->262|PF07690|8e-11|27.6|239/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 18->339|PF07690|2.8e-43|25.7|319/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 30->263|1pv6A|3e-09|17.7|231/417|f.38.1.2| HM:SCP:REP 1->380|1pw4A_|2.4e-56|25.7|378/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 472 OP:NHOMOORG 336 OP:PATTERN ---------11-----------------1--------------------------1------------ --2---12111------22-21--112222211111-1--2----11-1-----1-----21111--121----------1-11-1---------------1------1-----------------------------------2-31--11-----1111111-----11------------11--------2111111-111111113233-2111-21----------1-1111111111111111111--------1---11-1--------------------------------------------------------------------1-------------------1-------------------2113-----111--432-----1111-11-111-113113121-------112111221--11--2----1--11111111----1----------------------------------111-----21----1122221111333323-122242--1211211112211-1-111111-----------21-------------------21---------1-------------------------11----122-1-1-1-------2-11---11-33----1--------1111-1-2222222222-2222222222222222221-1111--12-2322222212222211112221--1--------------1---11----1221-----------------------1-21-22221-11111111111----------1--1-------1--11-1112-------11---------------------------------------------1--------1-- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 382-383| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccc //