[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56679.1
DDBJ      :             pyridoxamine 5'-phosphate oxidase-related FMN- binding
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  42/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->152 2fg9A PDBj 3e-08 30.3 %
:RPS:PDB   11->153 3dmbA PDBj 3e-15 13.2 %
:RPS:SCOP  15->157 2fg9A1  b.45.1.1 * 3e-27 26.8 %
:HMM:SCOP  7->164 2fg9A1 b.45.1.1 * 9.5e-33 41.2 %
:RPS:PFM   16->74 PF01243 * Pyridox_oxidase 1e-05 45.6 %
:HMM:PFM   15->106 PF01243 * Pyridox_oxidase 2.4e-13 23.5 81/89  
:HMM:PFM   119->134 PF10815 * ComZ 0.00026 50.0 16/56  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56679.1 GT:GENE ACV56679.1 GT:PRODUCT pyridoxamine 5'-phosphate oxidase-related FMN- binding GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3166622..3167239 GB:FROM 3166622 GB:TO 3167239 GB:DIRECTION + GB:PRODUCT pyridoxamine 5'-phosphate oxidase-related FMN- binding GB:NOTE PFAM: pyridoxamine 5'-phosphate oxidase-related FMN- binding; KEGG: glo:Glov_0247 LexA DNA-binding domain protein GB:PROTEIN_ID ACV56679.1 GB:DB_XREF GI:257476359 InterPro:IPR011576 LENGTH 205 SQ:AASEQ MTRFPLRRAERAMPRDEALAVLDAAEFAIVSTVDDDGMPYGVPLSFVRRGDTLYFHATNEGGHKTVDFRRDDRVCATAVTGVEAFFEDGDFSTSFRSAITFGRVREVVEATEFKHALVDLCMKYVPEAKRSIGKAMEKEGPHTSVWAIDIEEISGKAHPGPRGDASGDGRTDAADDGGCAGTDAGRQTDPVAGAEPVAALGGEGA GT:EXON 1|1-205:0| SEG 162->186|rgdasgdgrtdaaddggcagtdagr| BL:PDB:NREP 1 BL:PDB:REP 20->152|2fg9A|3e-08|30.3|122/158| RP:PDB:NREP 1 RP:PDB:REP 11->153|3dmbA|3e-15|13.2|121/142| RP:PFM:NREP 1 RP:PFM:REP 16->74|PF01243|1e-05|45.6|57/88|Pyridox_oxidase| HM:PFM:NREP 2 HM:PFM:REP 15->106|PF01243|2.4e-13|23.5|81/89|Pyridox_oxidase| HM:PFM:REP 119->134|PF10815|0.00026|50.0|16/56|ComZ| GO:PFM:NREP 1 GO:PFM GO:0010181|"GO:FMN binding"|PF01243|IPR011576| RP:SCP:NREP 1 RP:SCP:REP 15->157|2fg9A1|3e-27|26.8|138/153|b.45.1.1| HM:SCP:REP 7->164|2fg9A1|9.5e-33|41.2|153/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 60 OP:NHOMOORG 45 OP:PATTERN --------------------------------------------1-------1--------------- ----------------------------------------------------------------1---------------11------111--111---------------------------------------------------------------------------------------1-----------------------------------------------------------------------1--------------------------------------------------------------------221-2311332-2--111-----1-1--2---11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---1----1-12--1-----------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 76.6 SQ:SECSTR ####HHHHccHHHHHHHHHHHHHHHcEEEEETTccccccEEEEEccccccccEEEEEEcTTcTTHHHHTTcEEEEEEEEEcTTcEEcTTEcTTccEEEEEEEEEEEcccHHHHHHHccHHHHHHcTTGGGccTTcHTcccTTcEEEEEEEEEEHHHcTTcc############################################ DISOP:02AL 204-206| PSIPRED ccccccccccccccHHHHHHHHHHccEEEEEEEccccccEEEEEEEEEEccEEEEEEcccccHHHHHHHccccEEEEEEccccHHHccccccEEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEccEEEEEEEccccccccccccccccccccEEEEEccEEEccccccccccccccccc //