[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56697.1
DDBJ      :             ABC transporter related
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  903/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:247 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   12->70 2awoD PDBj 1e-07 37.3 %
:BLT:PDB   46->243 1vplA PDBj 6e-26 29.3 %
:RPS:PDB   10->224 2dwoA PDBj 5e-35 7.0 %
:RPS:SCOP  10->240 1ji0A  c.37.1.12 * 1e-35 25.5 %
:HMM:SCOP  14->228 1ii8.1 c.37.1.12 * 1.1e-56 34.7 %
:RPS:PFM   51->169 PF00005 * ABC_tran 7e-05 28.9 %
:HMM:PFM   51->170 PF00005 * ABC_tran 2.2e-17 28.9 114/118  
:HMM:PFM   22->74 PF03193 * DUF258 2.6e-05 21.2 52/161  
:BLT:SWISS 8->222 YDBJ_BACSU 2e-41 39.2 %
:PROS 143->157|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56697.1 GT:GENE ACV56697.1 GT:PRODUCT ABC transporter related GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3188686..3189429) GB:FROM 3188686 GB:TO 3189429 GB:DIRECTION - GB:PRODUCT ABC transporter related GB:NOTE PFAM: ABC transporter related; SMART: AAA ATPase; KEGG: bcz:BCZK4584 ABC transporter, ATP-binding protein GB:PROTEIN_ID ACV56697.1 GB:DB_XREF GI:257476377 InterPro:IPR003439 InterPro:IPR003593 InterPro:IPR017871 LENGTH 247 SQ:AASEQ MTAEQKKAAPVLSVNHVVKAFGAKRAVDDVTLDVMPGDIFGFVGHNGAGKTTLIRAIVGVTGFDEGDIRIAGQSVKTDALACKRMTAYVPDNPDIYEFLTGIQYLNYLSDIFEVPADVRERRIRAYADRLSLTSALGDLISSYSHGMRQKLVLIGALVHQPTLLVLDEPFVGLDPEASFHVKEMLRELADGGSAVFFSSHVLEVVEKLCNKVAIIKQGTLRACGPTADVVGDESLEDVFLDMIDRNA GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 8->222|YDBJ_BACSU|2e-41|39.2|212/308| PROS 143->157|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 2 BL:PDB:REP 12->70|2awoD|1e-07|37.3|59/299| BL:PDB:REP 46->243|1vplA|6e-26|29.3|198/238| RP:PDB:NREP 1 RP:PDB:REP 10->224|2dwoA|5e-35|7.0|199/449| RP:PFM:NREP 1 RP:PFM:REP 51->169|PF00005|7e-05|28.9|114/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 51->170|PF00005|2.2e-17|28.9|114/118|ABC_tran| HM:PFM:REP 22->74|PF03193|2.6e-05|21.2|52/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 10->240|1ji0A|1e-35|25.5|231/240|c.37.1.12| HM:SCP:REP 14->228|1ii8.1|1.1e-56|34.7|213/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 32912 OP:NHOMOORG 1165 OP:PATTERN MME5IKCIIJIHIHNJZCDHEHHQiLPabUWMB9B8B3AABA9LXKSSFKpfU8KUJNVGLEFAQ147 IPgE*NSTYYZXWPNKMGG-Ga88O*HHHHHGhjhlk***MrM*YsdaaXUFolkHIMCCdewVskk***RLKKKeNONJoRa74657EDME2F7BB--ABHABFSEMJK33443334554555BIF9FFD9GEMHchggeFFGoVbabhTSVUXNPGAEGEBRWQVnofKCC8E899F9G87aSSKHeS4Lak*****y**m*******quumk***YfjwpZgfijged**VXXXWXWTWWXXXVWPSMOUdPUKosJGKJPjiGHruSNKPaPSTUVTWedXfZiiYZYXWXabaYXSRRRRSTTSSSRSiaaQPPcbddbrgowvvvptrqUrYYrhhRQUR*dVdXsZZLC**RRKUXRLPTKUZIMNRFSLMNECHCCHTG***KGeypr*ez*yx*u*tyv*-RS*SM*Tn**G8*************uEBHru*zq***m*JIJJJJJJgNPFDUPn55415344224454543565435567373A99AA8n**jwy*****giijfvv**qjnmYn***pmzi7KhgchUeVWvl****NVTFMCETHFCECDDDDGEMVTPh*KQJWXGQgMLTCPIRHLNSEMPPQQdnMjAEEI79898BA463343333AC9ADGEXThFXJNAJCVLLMNMEJPNNNNNOQLPQN3-8FDDF-1----sk*zMrjgiiehgdhef-gfefjdfghehfgddfedd*****TULaZVXWYYZYZXVYVXW*bYRdddaF3jsuvyvvsuyyx228BAEBABDCDDJElZyONOOMPBEGFEMGKRDEDCE7J9EDaNdegcdooxjciacT*xz989797988CRTReWXWXXjgbXYJIGEDFECCD988943GHHGCEBD54444444g9I85635-467357165578B452223KZaLOTpUZS7SF --11TTC-KA37BN8997599FBFFGFA936565645755377756989BBFJCBA4766777-244314621432716522322A35-8F596684142246CBA3LIHPIDFMKGB996BEDaU8TBr*U3UGWFDE9OA7KD9DA8AMA9u9JJDS6CVBGDU4UNP*DGJ6CBA6*776BDcSQk5dcB6*k**F ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 246-248| PSIPRED ccccccccccEEEEEEEEEEEccEEEEEEEEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHccHHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEEccEEEEEccHHHHHHHcccEEEEEEEEcccc //