[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56702.1
DDBJ      :             putative transcriptional regulator, Crp/Fnr family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:238 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->226 2h6bA PDBj 2e-11 20.4 %
:RPS:PDB   14->229 3e6cC PDBj 2e-15 17.7 %
:RPS:SCOP  174->226 1zybA1  a.4.5.4 * 7e-07 28.3 %
:HMM:SCOP  22->151 1ft9A2 b.82.3.1 * 1.6e-06 18.6 %
:HMM:SCOP  152->229 2cohA1 a.4.5.4 * 2.4e-10 29.9 %
:HMM:PFM   182->215 PF01047 * MarR 1.9e-07 32.4 34/59  
:HMM:PFM   51->125 PF00027 * cNMP_binding 0.00063 21.9 73/91  
:BLT:SWISS 53->211 CRP_PASMU 1e-04 25.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56702.1 GT:GENE ACV56702.1 GT:PRODUCT putative transcriptional regulator, Crp/Fnr family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3195910..3196626 GB:FROM 3195910 GB:TO 3196626 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator, Crp/Fnr family GB:NOTE KEGG: dde:Dde_0463 Crp/FNR family transcriptional regulator GB:PROTEIN_ID ACV56702.1 GB:DB_XREF GI:257476382 InterPro:IPR012318 LENGTH 238 SQ:AASEQ MATEQEYRSILIPNQPFRRLKIADYISQGKKKKLFKGEYIRTSAKTIDDLYYYYIDEGQIVATFEQESGEVAPLYWRNAGNAFSAEYNDYASIGRYKARFIAAQNTVLFAFTQRQLYELSQDDPELFYEFINVCHMSFAQMGHRISNTGYQSSTKRMIMWLQKLCATQECDEHGVYDIECKLTLQQLSELLSIHITTCTKIVAALENEGVIERTRTRIRIFDAQRLAQYGLEDTPLAY GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 53->211|CRP_PASMU|1e-04|25.5|149/209| BL:PDB:NREP 1 BL:PDB:REP 5->226|2h6bA|2e-11|20.4|211/239| RP:PDB:NREP 1 RP:PDB:REP 14->229|3e6cC|2e-15|17.7|209/225| HM:PFM:NREP 2 HM:PFM:REP 182->215|PF01047|1.9e-07|32.4|34/59|MarR| HM:PFM:REP 51->125|PF00027|0.00063|21.9|73/91|cNMP_binding| RP:SCP:NREP 1 RP:SCP:REP 174->226|1zybA1|7e-07|28.3|53/73|a.4.5.4| HM:SCP:REP 22->151|1ft9A2|1.6e-06|18.6|118/0|b.82.3.1|1/1|cAMP-binding domain-like| HM:SCP:REP 152->229|2cohA1|2.4e-10|29.9|77/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 6 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 97.9 SQ:SECSTR ccccHHHHHHHTTccccccccGGGGGGGcEEEEEcTTcEEEcTTcccccEcEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEccccccccccccccEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcEEETTEEEEEccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEEccHHHHHHHcHHH##### PSIPRED ccccccccccccccccccHHHHHHHHHcccEEEEccccEEEcccccccEEEEEEEEEEEEEEEEEcccccEEEEEEEcccccccHHHHcccccccEEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHHcccccccc //