[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56703.1
DDBJ      :             drug resistance transporter, EmrB/QacA subfamily
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  586/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:471 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->183 1pw4A  f.38.1.1 * 1e-09 12.7 %
:HMM:SCOP  14->471 1pw4A_ f.38.1.1 * 2e-54 23.7 %
:RPS:PFM   66->183 PF07690 * MFS_1 5e-10 31.4 %
:HMM:PFM   39->423 PF07690 * MFS_1 5.9e-34 24.3 334/353  
:BLT:SWISS 40->427 YHCA_BACSU 1e-54 35.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56703.1 GT:GENE ACV56703.1 GT:PRODUCT drug resistance transporter, EmrB/QacA subfamily GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3196862..3198277) GB:FROM 3196862 GB:TO 3198277 GB:DIRECTION - GB:PRODUCT drug resistance transporter, EmrB/QacA subfamily GB:NOTE TIGRFAM: drug resistance transporter, EmrB/QacA subfamily; PFAM: major facilitator superfamily MFS_1; KEGG: bcy:Bcer98_3254 EmrB/QacA family drug resistance transporter GB:PROTEIN_ID ACV56703.1 GB:DB_XREF GI:257476383 InterPro:IPR001411 InterPro:IPR004638 InterPro:IPR007114 InterPro:IPR011701 LENGTH 471 SQ:AASEQ MRWWETEGRRHAGMKRVKSERMGVYALFAIVVLASASGNLSQTAVNAMLGDIMLQFGLTVDLGQWLTTSYMLVLGITVPVATFLSRRFSVRQHVFIALAFFLVGALADLFAPNFGVLLAGRVFQAISTGMLMPLMQTIAMTRFPRGRQATAMGVAGIAMGFAPNIGPTIGGAMSFSLGWRSFFVLLVVIMLALAAAAAVAIKPSAAPDKSARLDVVSLAQSTLGFGGLLLAFSNASSFSFESPFIWAPLVLGALFLVLFVRRQKRVDDPLISMDIFSSRQYRAGFIAQNLLNASFMGVTLIVPLYVEGLCGGTALEAGVVLLPGTVAALVLNPLAGVLTDKVGVRPVALVSGAFLATGAVLMSFLDADTPLYVTTLCQAVRAVGVSGLVGPLTSWSLAQLPRPIVADGSSFCISARQACASLGTSVMVFLIAVAGASAAGLANPALAYQLAFGFSAVMAVATLGFIVAKVR GT:EXON 1|1-471:0| BL:SWS:NREP 1 BL:SWS:REP 40->427|YHCA_BACSU|1e-54|35.9|387/532| TM:NTM 14 TM:REGION 19->41| TM:REGION 64->85| TM:REGION 94->116| TM:REGION 121->143| TM:REGION 152->174| TM:REGION 181->203| TM:REGION 215->236| TM:REGION 242->260| TM:REGION 285->307| TM:REGION 316->338| TM:REGION 345->367| TM:REGION 370->392| TM:REGION 421->443| TM:REGION 448->469| SEG 184->201|vllvvimlalaaaaavai| SEG 232->244|fsnassfsfespf| SEG 249->260|lvlgalflvlfv| SEG 432->447|avagasaaglanpala| RP:PFM:NREP 1 RP:PFM:REP 66->183|PF07690|5e-10|31.4|118/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 39->423|PF07690|5.9e-34|24.3|334/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 25->183|1pw4A|1e-09|12.7|158/434|f.38.1.1| HM:SCP:REP 14->471|1pw4A_|2e-54|23.7|393/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1881 OP:NHOMOORG 641 OP:PATTERN ------3211111111-------1--------1121--11---24211--111-------11111--- 324-B2145552-222122-23--7322222253346587-3453451132-2222-2--3351125765-32224541262-1211111-----------1---5-1-1--------------1111---111--222-311152-----------------------2-------------111-----52B9999999A399978772775699812234424344444J24333343333334353347258188152-29766AA43695A664222-1-1122-----------11111111111111--------1---67---1---1-112661111-----2--2-122221--2321-----11-711211112225332113211111331333333-1121142426--83339829883322-1-11-1111---1111111121111212------------11--111111111------242221122ACDADC6888699A9786738E7B6677--436-132231423124-----221111111---112-1111-1--1-----2-11113-111-11--1----------------------11-44332-21--11-11111-12222-1111-11-------------21531333323344333-33333343333333333322523522321-2223111222222533243421-333333333333----43232------21-111-11-11------33333-2223--2232675715452-343-1---11-1-2332222221-1--33322222221-----------------------------------------------------------11- -------------1----11-1--2--111-------------1111-2111-2--112-----1----1----1--------------1--------------2---------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 470-472| PSIPRED cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccc //