[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56706.1
DDBJ      :             protein of unknown function DUF1648
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.102.4
:227 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  61->185 1c3dA  a.102.4.4 * 7e-04 23.3 %
:RPS:PFM   51->90 PF07853 * DUF1648 1e-04 48.6 %
:HMM:PFM   37->84 PF07853 * DUF1648 2.7e-14 31.2 48/51  
:BLT:SWISS 53->92 Y163_ARCFU 4e-05 37.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56706.1 GT:GENE ACV56706.1 GT:PRODUCT protein of unknown function DUF1648 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3202373..3203056 GB:FROM 3202373 GB:TO 3203056 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF1648 GB:NOTE PFAM: protein of unknown function DUF1648; KEGG: kpe:KPK_0289 tryptophan/tyrosine permease family protein GB:PROTEIN_ID ACV56706.1 GB:DB_XREF GI:257476386 InterPro:IPR012867 LENGTH 227 SQ:AASEQ MAENETDRNEPCEPDIDEVAVAPAYRMSRGRVALLAVLAILPVVLTALAQPFLPDSVPLHYGASGPDRWGSKGELFVAAGIITVIAFVLVAVYAVVEHQRETGREDWLVVDGPVTSMFPVFSICLAIIDCLDAAYVFAAFQLGGFSMPENMGSLIGGIVCLVVALSLLTPALYMLITGKGLSLVNFHPGTSDLEKRTGADKQQARAIGGLLLFLTVIVLVELLVTVK GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 53->92|Y163_ARCFU|4e-05|37.5|40/100| TM:NTM 5 TM:REGION 23->45| TM:REGION 73->95| TM:REGION 119->141| TM:REGION 156->178| TM:REGION 205->227| SEG 32->49|vallavlailpvvltala| SEG 210->226|lllfltvivlvellvtv| RP:PFM:NREP 1 RP:PFM:REP 51->90|PF07853|1e-04|48.6|35/55|DUF1648| HM:PFM:NREP 1 HM:PFM:REP 37->84|PF07853|2.7e-14|31.2|48/51|DUF1648| RP:SCP:NREP 1 RP:SCP:REP 61->185|1c3dA|7e-04|23.3|116/294|a.102.4.4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-87,90-90,95-95,109-109,115-115,118-118,123-123,157-158,160-160,165-165,179-179,185-185,193-193,207-207,227-228| PSIPRED cccccccccccccccHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //