[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56711.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  194/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:211 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   50->107 2fug9 PDBj 2e-05 41.1 %
:BLT:PDB   120->172 2fdnA PDBj 1e-07 45.8 %
:RPS:PDB   53->107 1bluA PDBj 3e-05 27.5 %
:RPS:PDB   116->171 3bk7A PDBj 4e-09 30.4 %
:RPS:SCOP  53->107 1jb0C  d.58.1.2 * 4e-06 24.5 %
:RPS:SCOP  92->172 1hfeL2  d.58.1.5 * 2e-10 26.4 %
:RPS:SCOP  152->186 1jb0C  d.58.1.2 * 3e-04 28.6 %
:HMM:SCOP  43->173 1h0hB_ d.58.1.5 * 2e-17 30.9 %
:HMM:PFM   52->68 PF00037 * Fer4 0.00061 41.2 17/24  
:HMM:PFM   90->107 PF00037 * Fer4 2e-08 55.6 18/24  
:HMM:PFM   133->146 PF00037 * Fer4 0.00076 50.0 14/24  
:HMM:PFM   154->173 PF00037 * Fer4 6.5e-10 50.0 20/24  
:BLT:SWISS 38->171 MAUM_PARDP 9e-18 43.2 %
:BLT:SWISS 156->194 HDRA1_METKA 6e-06 53.8 %
:PROS 92->103|PS00198|4FE4S_FER_1
:PROS 161->172|PS00198|4FE4S_FER_1
:REPEAT 4|52->69|91->108|134->146|161->177
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56711.1 GT:GENE ACV56711.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3207301..3207936) GB:FROM 3207301 GB:TO 3207936 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: dvm:DvMF_2713 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:PROTEIN_ID ACV56711.1 GB:DB_XREF GI:257476391 InterPro:IPR001450 InterPro:IPR017900 LENGTH 211 SQ:AASEQ MAAYTRRAFAGFCGAAAVFAAFGGAVKAADGASETALVRPPGAQDELHLLASCVKCDRCRSVCHTGVIGVAEVGDGFLRARTPKLNFHRGSCDFCGDCQRVCPTGAIGAFDPEADKMGMAVVQKDRCVAYYQGCVECQKACPFEAIALDGDGHPVVDADRCNGCGVCEDVCPALVYRSFSGGTRRGIVVVSPSAYARLGKTVVEDESEMSA GT:EXON 1|1-211:0| BL:SWS:NREP 2 BL:SWS:REP 38->171|MAUM_PARDP|9e-18|43.2|132/224| BL:SWS:REP 156->194|HDRA1_METKA|6e-06|53.8|39/669| PROS 92->103|PS00198|4FE4S_FER_1|PDOC00176| PROS 161->172|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 4|52->69|91->108|134->146|161->177| SEG 8->32|afagfcgaaavfaafggavkaadga| BL:PDB:NREP 2 BL:PDB:REP 50->107|2fug9|2e-05|41.1|56/154| BL:PDB:REP 120->172|2fdnA|1e-07|45.8|48/55| RP:PDB:NREP 2 RP:PDB:REP 53->107|1bluA|3e-05|27.5|51/80| RP:PDB:REP 116->171|3bk7A|4e-09|30.4|56/593| HM:PFM:NREP 4 HM:PFM:REP 52->68|PF00037|0.00061|41.2|17/24|Fer4| HM:PFM:REP 90->107|PF00037|2e-08|55.6|18/24|Fer4| HM:PFM:REP 133->146|PF00037|0.00076|50.0|14/24|Fer4| HM:PFM:REP 154->173|PF00037|6.5e-10|50.0|20/24|Fer4| RP:SCP:NREP 3 RP:SCP:REP 53->107|1jb0C|4e-06|24.5|53/80|d.58.1.2| RP:SCP:REP 92->172|1hfeL2|2e-10|26.4|72/85|d.58.1.5| RP:SCP:REP 152->186|1jb0C|3e-04|28.6|35/80|d.58.1.2| HM:SCP:REP 43->173|1h0hB_|2e-17|30.9|123/214|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 393 OP:NHOMOORG 212 OP:PATTERN ---1-1----------1---------------31642144455--1---3-1-4-------------- --------------------------------------------------------------------------------85---2-22231-3-------------------------------------11-------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------1--------------------------2----22----------------------------------------------------1---1--------11---1---11-----2-1-3------------------2-----------------------------------------1---------------------------------1------------2-11--2-----------22-232-22-11---1-1112-2--------111211111111-1-1-------22212--33---------2111111212222221221-------------1---3--2222222222-2222222212222222223---22---2222222212222221-2222212--122222222222------------------333212232322113---------------1-----------------------11141111123112----------------3-11--11--------------------------------------1--------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 66.8 SQ:SECSTR #################################HHHHHHHHHHHHHHHccccccHHHHHHHHHHHTGcEEEcTTTccEEEccGHHHHGGGccccccHccTTcccTTccccccccccEEEEEccGGGccTTTccccHHHHHcHHHHTTcTTTTEEEEcTTTcccccHHHHHcTHT##################################### PSIPRED cccccHHHHHHHHHHHHHHHHccHHHcccccccccccccccccccHHHHHHHcccccHHHHHcccccEEEEEcccccccccccEEEEEcccccccccHHHHHHHHHccccccHHHcccccEEEccccccccccccHHHHHcccccEEEcccccEEEEcccccccccHHHHcccccEEEcccccEEEEEEEccccccccccccccccHHHcc //