[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56724.1
DDBJ      :             phosphopantetheine-binding
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:72 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->70 3gzmB PDBj 2e-08 39.1 %
:RPS:PDB   2->72 2afdA PDBj 2e-07 18.3 %
:RPS:SCOP  3->69 1f80D  a.28.1.1 * 2e-06 37.3 %
:HMM:SCOP  1->73 1dv5A_ a.28.1.3 * 2.2e-11 34.2 %
:HMM:PFM   5->69 PF00550 * PP-binding 2.4e-16 32.3 65/67  
:BLT:SWISS 1->71 ACP_ARCB4 2e-11 43.7 %
:PROS 30->45|PS00012|PHOSPHOPANTETHEINE
:REPEAT 2|5->36|37->72

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56724.1 GT:GENE ACV56724.1 GT:PRODUCT phosphopantetheine-binding GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3221667..3221885 GB:FROM 3221667 GB:TO 3221885 GB:DIRECTION + GB:PRODUCT phosphopantetheine-binding GB:NOTE PFAM: phosphopantetheine-binding; KEGG: abu:Abu_2057 acyl carrier protein, putative GB:PROTEIN_ID ACV56724.1 GB:DB_XREF GI:257476404 InterPro:IPR006162 InterPro:IPR006163 LENGTH 72 SQ:AASEQ MATIDTIKTILEENLDIDPSTVEESSTFDSLGIDSLDMVELICDLEEACDVDFGEPEGLDTVGSLVEYIDSL GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 1->71|ACP_ARCB4|2e-11|43.7|71/76| PROS 30->45|PS00012|PHOSPHOPANTETHEINE|PDOC00012| NREPEAT 1 REPEAT 2|5->36|37->72| BL:PDB:NREP 1 BL:PDB:REP 2->70|3gzmB|2e-08|39.1|69/81| RP:PDB:NREP 1 RP:PDB:REP 2->72|2afdA|2e-07|18.3|71/88| HM:PFM:NREP 1 HM:PFM:REP 5->69|PF00550|2.4e-16|32.3|65/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 3->69|1f80D|2e-06|37.3|67/74|a.28.1.1| HM:SCP:REP 1->73|1dv5A_|2.2e-11|34.2|73/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 48 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------121----------------------------------------------------------------------------------1----------------1-------------------------------------------------------------------------------------------------11111111-------------11111111111111111111111-----1111111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHTccGGGccTTccGGGTTcccTHHHHHHHHHHHHTTccccGGGTTTcHHHHHHHHHHH PSIPRED ccHHHHHHHHHHHHccccHHHccccccHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcc //