[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56755.1
DDBJ      :             ribosomal protein L36
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  359/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:37 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->37 2hgu8 PDBj 8e-16 81.1 %
:RPS:PDB   1->37 3bbo6 PDBj 1e-07 70.3 %
:HMM:SCOP  1->37 2i2t41 g.42.1.1 * 4.6e-15 67.6 %
:RPS:PFM   1->37 PF00444 * Ribosomal_L36 6e-04 70.3 %
:HMM:PFM   1->37 PF00444 * Ribosomal_L36 4.6e-24 70.3 37/38  
:BLT:SWISS 1->37 RL36_PROAC 5e-17 83.8 %
:PROS 11->36|PS00828|RIBOSOMAL_L36

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56755.1 GT:GENE ACV56755.1 GT:PRODUCT ribosomal protein L36 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3256033..3256146) GB:FROM 3256033 GB:TO 3256146 GB:DIRECTION - GB:PRODUCT ribosomal protein L36 GB:NOTE TIGRFAM: ribosomal protein L36; PFAM: ribosomal protein L36; KEGG: rpmJ; 50S ribosomal protein L36 GB:PROTEIN_ID ACV56755.1 GB:DB_XREF GI:257476435 InterPro:IPR000473 LENGTH 37 SQ:AASEQ MKVRPSVKKMCDKCKIIRRHGKVLVICENPRHKQRQG GT:EXON 1|1-37:0| BL:SWS:NREP 1 BL:SWS:REP 1->37|RL36_PROAC|5e-17|83.8|37/37| PROS 11->36|PS00828|RIBOSOMAL_L36|PDOC00650| BL:PDB:NREP 1 BL:PDB:REP 1->37|2hgu8|8e-16|81.1|37/37| RP:PDB:NREP 1 RP:PDB:REP 1->37|3bbo6|1e-07|70.3|37/38| RP:PFM:NREP 1 RP:PFM:REP 1->37|PF00444|6e-04|70.3|37/38|Ribosomal_L36| HM:PFM:NREP 1 HM:PFM:REP 1->37|PF00444|4.6e-24|70.3|37/38|Ribosomal_L36| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00444|IPR000473| GO:PFM GO:0005622|"GO:intracellular"|PF00444|IPR000473| GO:PFM GO:0005840|"GO:ribosome"|PF00444|IPR000473| GO:PFM GO:0006412|"GO:translation"|PF00444|IPR000473| HM:SCP:REP 1->37|2i2t41|4.6e-15|67.6|37/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 373 OP:NHOMOORG 369 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-1---1111111111111111111-1111111111111111111111111111-111111111----11-----------------------------------------------------111-----1---1111111111---1111-111----11-1-1111111-1111111111-1111111111111--111--11111-111111111111-111111111111111111111-1111111111-111111-1111111-11---11-11111111111111111--1111111-11111111111111111111111-11-1-111--111111-1111---1-------------------------------------------------------------------------------------------------------------------------------11111---------------------------------1-----11-----------1------------1-----1--111111--------1------1--1----------------------1111-11-1-1---2-11-111-111111-11------1-1--------------------------------------------------1----------------------------------------111-1-------11111111-11-11-1111----------1-111-1--111-11111------------11111111111-----------------11-1-12-1--------11-----1--11---------------1-11---1------ -------------------------------------------------------------------------------------------1----111--1-------------------------------------------------------------------------1-----1-1----2-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 100.0 SQ:SECSTR cccccccccccTTcccEEETTEEEcccccGGGccccc DISOP:02AL 36-38| PSIPRED cccccHHHHHHcccEEEEEccEEEEEEccccHHHccc //