[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56760.1
DDBJ      :             ApbE family lipoprotein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  504/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.96.2
:308 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   14->239 1vrmA PDBj 2e-31 35.3 %
:RPS:SCOP  1->301 1vrmA1  d.96.2.1 * 2e-69 30.0 %
:HMM:SCOP  1->304 1vrmA1 d.96.2.1 * 5.9e-87 45.3 %
:RPS:PFM   33->286 PF02424 * ApbE 1e-54 47.6 %
:HMM:PFM   33->286 PF02424 * ApbE 2.2e-79 46.8 248/252  
:BLT:SWISS 58->302 APBE_TREPA 9e-41 40.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56760.1 GT:GENE ACV56760.1 GT:PRODUCT ApbE family lipoprotein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3260352..3261278 GB:FROM 3260352 GB:TO 3261278 GB:DIRECTION + GB:PRODUCT ApbE family lipoprotein GB:NOTE PFAM: ApbE family lipoprotein; KEGG: eta:ETA_19250 putative thiamine biosynthesis protein GB:PROTEIN_ID ACV56760.1 GB:DB_XREF GI:257476440 InterPro:IPR003374 LENGTH 308 SQ:AASEQ MVSRNFFRFNTTNIISAETDNEDILDEAVEWCDRYELLFSRVDPASELFRLNSAEGRPTAVDAELAAFIETALSYCREVDGLFDVTMGSATQLWNFKDCMIPARDDVAAALRHVDYRGVIVNDAVVTLRDPLACVDLGGIAKGYIADGILALLRERGVEHALVNLGGNVAVMGGKPDGAPWRVGVRRPLPSSSMPLLDSFAVLALRDGSAVTSGIYERAFEQDGKLYHHILDPRTGFPAETDLLSATVVAQSSLDADGYTTALIMMGADRALAFAEQHPALEAVLVTTEGDVLATSGIGDRVLFELLG GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 58->302|APBE_TREPA|9e-41|40.2|241/362| SEG 188->197|plpsssmpll| BL:PDB:NREP 1 BL:PDB:REP 14->239|1vrmA|2e-31|35.3|218/304| RP:PFM:NREP 1 RP:PFM:REP 33->286|PF02424|1e-54|47.6|248/253|ApbE| HM:PFM:NREP 1 HM:PFM:REP 33->286|PF02424|2.2e-79|46.8|248/252|ApbE| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF02424|IPR003374| RP:SCP:NREP 1 RP:SCP:REP 1->301|1vrmA1|2e-69|30.0|293/309|d.96.2.1| HM:SCP:REP 1->304|1vrmA1|5.9e-87|45.3|296/0|d.96.2.1|1/1|ApbE-like| OP:NHOMO 670 OP:NHOMOORG 509 OP:PATTERN -------------------------------------------------11----------------- --4-1-----------------------------------111-------------------1-2--21---------1232------1111-2111---131123-4-111111111111111111-1-112-21111111111-------------------------------------------11-2---------------------------------11111111----------------11--21-144-1111331133-112-122211121-11111111111111111111111111111221112221112251111111-1-2111122-12111121--22---121--1111-1-1-21111-----1-11211212-1222222121221-11311211-1---------1---1-211-1-21211-11------------111---------------------------------1-1-1-12-------2111----222212---1223--11222-2212-11-111111--112111111--211-11211111-311-----1---1-1111-111-----------------------11--222124212112222213422223423242--12112-1----11221221111111111-1111111111111111111222221111111111111111111211111111-111111111111---2---------22213111111111111111-------212121111111-111211111---------1111111111211111111111---11111111--------------111-------------------------1111111111-11 --------21---------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 90.3 SQ:SECSTR #############EEEcccccHHHHHHHHHHHHHHHHHTccccTTcHHHHHHTcccccEEccHHHHHHHHHHHHHHHHTTTcccTTTHHHHHHHcGGGcccccHHHHHHHHTTccGGGEEEETTTEEEcTTccccccTTTHHHHHHHHHHHHHHcTTcEcEEEEETTEEEEEEccTTTccEEEEEEccccc#cTTcccEEEEEEEcccEEEEEETTccEEEETTEEEEccccTTTcccccccEEEEEEEEccHHHHHHHHHHHH#HcHHHHHHHHHHHTc##EEEEEEccccEEE############# PSIPRED ccEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccEEccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHccccccEEEEcccEEEEEcccEEEEcccHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEEcccccccEEEEEEcccccccccccccEEEEEEcccEEEEccccccEEEEccEEEEEEEcccccccccccEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHccccEEEEEcccccEEEcccHHHHHHHHHcc //