[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56768.1
DDBJ      :             chaperonin Cpn10
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  600/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
b.35.1
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->93 1p3hB PDBj 1e-16 45.2 %
:RPS:PDB   3->93 2c7cO PDBj 2e-14 31.9 %
:RPS:SCOP  1->93 1aonO  b.35.1.1 * 9e-09 33.3 %
:HMM:SCOP  1->96 1aonO_ b.35.1.1 * 3.8e-31 51.0 %
:RPS:PFM   3->93 PF00166 * Cpn10 1e-13 46.2 %
:HMM:PFM   2->94 PF00166 * Cpn10 7.9e-33 49.5 93/93  
:BLT:SWISS 1->93 CH10_CHLL2 1e-19 49.5 %
:PROS 3->27|PS00681|CHAPERONINS_CPN10
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56768.1 GT:GENE ACV56768.1 GT:PRODUCT chaperonin Cpn10 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3276201..3276488) GB:FROM 3276201 GB:TO 3276488 GB:DIRECTION - GB:PRODUCT chaperonin Cpn10 GB:NOTE PFAM: chaperonin Cpn10; KEGG: gme:Gmet_0028 co-chaperonin GroES GB:PROTEIN_ID ACV56768.1 GB:DB_XREF GI:257476448 InterPro:IPR001476 LENGTH 95 SQ:AASEQ MNLKPLGDRVIVKQDEAEETTASGLFLATEAKEKPQSGTVLAVGEGKLDKDGNLVPVPVKVGDKVVYGKFGGTEINVEGEDVLILRGDDLYAVFA GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 1->93|CH10_CHLL2|1e-19|49.5|93/95| PROS 3->27|PS00681|CHAPERONINS_CPN10|PDOC00576| SEG 55->72|vpvpvkvgdkvvygkfgg| BL:PDB:NREP 1 BL:PDB:REP 1->93|1p3hB|1e-16|45.2|93/98| RP:PDB:NREP 1 RP:PDB:REP 3->93|2c7cO|2e-14|31.9|91/92| RP:PFM:NREP 1 RP:PFM:REP 3->93|PF00166|1e-13|46.2|91/93|Cpn10| HM:PFM:NREP 1 HM:PFM:REP 2->94|PF00166|7.9e-33|49.5|93/93|Cpn10| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00166|IPR001476| GO:PFM GO:0005737|"GO:cytoplasm"|PF00166|IPR001476| GO:PFM GO:0006457|"GO:protein folding"|PF00166|IPR001476| RP:SCP:NREP 1 RP:SCP:REP 1->93|1aonO|9e-09|33.3|93/97|b.35.1.1| HM:SCP:REP 1->96|1aonO_|3.8e-31|51.0|96/97|b.35.1.1|1/1|GroES-like| OP:NHOMO 740 OP:NHOMOORG 612 OP:PATTERN -------------------------------------------------------------------- 1121111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111211111111111-11-1---1111111111111-----1111221111-11111-1111111111111111111111111111111111111111-1-11-11111111111111111111111111111-11--11-1-1111--11111------------11---------------------------111----1-1-111111111111-1111111----1111111111-111211111--1-21112111111153433222222----------1-2233231125--311-43334134221-1-1111112111111111111111-12------------1111111111111----1211211111-32333322222221133332222511111122111111111111111111222111111111-1211111111111211111111111-1111112211--------------------1-1111-----1---1-1111111111111111111--11111-1------------------------------------------------------------------------------------------1---------21--1-----------1---111111111111----111-111111111111111111--1111111111111111111111111111-1-111111--------11------------------------------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-21------24482-22-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 97.9 SQ:SECSTR ccccccccEEEEEEcccccTTTTcccccccccccccEEEEEEEcccccTTcccccccccTTcEEEEccccccEEEEETTEEEEEEEGGGEEEc## PSIPRED cEEEEcccEEEEEEcccccccccEEEcccccccccEEEEEEEEcccEEcccccEEcccEEcccEEEEccccccEEEEccEEEEEEEHHHEEEEEc //