[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56777.1
DDBJ      :             hydrogenase nickel insertion protein HypA
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  214/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.9
:123 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->113 3a43B PDBj 3e-13 28.6 %
:RPS:PDB   2->113 3a44B PDBj 1e-22 31.2 %
:RPS:SCOP  68->93 1i3qL  g.41.9.2 * 7e-04 26.9 %
:RPS:PFM   1->113 PF01155 * HypA 6e-20 45.1 %
:HMM:PFM   1->112 PF01155 * HypA 2.3e-35 43.8 112/113  
:BLT:SWISS 1->113 HYPA_PELLD 3e-20 36.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56777.1 GT:GENE ACV56777.1 GT:PRODUCT hydrogenase nickel insertion protein HypA GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3287317..3287688) GB:FROM 3287317 GB:TO 3287688 GB:DIRECTION - GB:PRODUCT hydrogenase nickel insertion protein HypA GB:NOTE TIGRFAM: hydrogenase nickel insertion protein HypA; PFAM: hydrogenase expression/synthesis HypA; KEGG: ppd:Ppro_2782 hydrogenase nickel insertion protein HypA GB:PROTEIN_ID ACV56777.1 GB:DB_XREF GI:257476457 InterPro:IPR000688 LENGTH 123 SQ:AASEQ MHELGIMTGVMDAVTTSAQQAGATRVLKVSLSVGEMTEAIEDALMFAFEALSEGTLCEDAELQITMVKPKSRCLECGAEYEHDRFHMLCPECGSFATELIAGRELQIDSIEVDIPDDDEENED GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 1->113|HYPA_PELLD|3e-20|36.3|113/117| BL:PDB:NREP 1 BL:PDB:REP 2->113|3a43B|3e-13|28.6|112/117| RP:PDB:NREP 1 RP:PDB:REP 2->113|3a44B|1e-22|31.2|112/131| RP:PFM:NREP 1 RP:PFM:REP 1->113|PF01155|6e-20|45.1|113/113|HypA| HM:PFM:NREP 1 HM:PFM:REP 1->112|PF01155|2.3e-35|43.8|112/113|HypA| GO:PFM:NREP 2 GO:PFM GO:0006464|"GO:protein modification process"|PF01155|IPR000688| GO:PFM GO:0016151|"GO:nickel ion binding"|PF01155|IPR000688| RP:SCP:NREP 1 RP:SCP:REP 68->93|1i3qL|7e-04|26.9|26/46|g.41.9.2| OP:NHOMO 254 OP:NHOMOORG 231 OP:PATTERN ---1-------------------1--------11111111111-------1111-------------- 11----1--------------1---1------1111-111--1----------------------111-----------112-111-------1-------1-----------------------111-11-1-11-111-111--1111111-111------11--1111--------------------------------------------------------------------------------------------------------------------------------------------------------1----211222111-1-------1-1---1-1111----1-21--11----1-----------2213---121-1-------------------------------------------11111-----------1----1-2------------------------------------------------------1--------1--32------1------1----11--------------1-11-111-111--122212111111-1-----111-111--------1---------2112211---------1------1111------------1-1------1-111--1111111111-1111111111111111111--------1111111111111111-11-1111--1--------------------11111-1-----11--------------------1--------------------------------------------------------------------------1-------------------------------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 94.3 SQ:SECSTR #cccHHHHHHHHHHHHHHHTTTcccccEEEEEEETTccccHHHHHHHHHHHHTTcTTTTcEEEEEEEccEEEcTTTccEEEHHHHHTcccccccccccccccccccccccccccccc###### PSIPRED ccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccHHHHHHHHHHHHccccccccEEEEEEEccEEEEcccccEEEcccccccccccccccEEEccccEEEEEEEEcccccccccccc //