[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56781.1
DDBJ      :             amidohydrolase
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  433/915 : Eukaryota  112/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:451 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->442 1p1mA PDBj 5e-34 31.2 %
:RPS:PDB   11->437 1ejsC PDBj 3e-36 13.4 %
:RPS:SCOP  11->84 1onwA1  b.92.1.7 * 8e-09 15.1 %
:RPS:SCOP  56->367 2imrA2  c.1.9.16 * 4e-56 23.4 %
:RPS:SCOP  353->441 2pajA1  b.92.1.4 * 2e-14 15.9 %
:HMM:SCOP  57->372 1j6pA2 c.1.9.9 * 3.1e-72 35.3 %
:RPS:PFM   266->388 PF01979 * Amidohydro_1 4e-08 44.2 %
:HMM:PFM   54->388 PF01979 * Amidohydro_1 2.9e-45 32.6 270/328  
:BLT:SWISS 17->420 MTAD_DESRM 8e-49 31.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56781.1 GT:GENE ACV56781.1 GT:PRODUCT amidohydrolase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3289819..3291174) GB:FROM 3289819 GB:TO 3291174 GB:DIRECTION - GB:PRODUCT amidohydrolase GB:NOTE PFAM: amidohydrolase; Amidohydrolase 3; KEGG: hypothetical protein GB:PROTEIN_ID ACV56781.1 GB:DB_XREF GI:257476461 InterPro:IPR006680 InterPro:IPR013108 LENGTH 451 SQ:AASEQ MLLCAQYILPITSEPFQKGAVLVRDNVIRDIGTAEMLKLRYPDEEVVDFGQAAIMPGLVDLHTHLENSVMRGIVHDVPYTTWVTSMLEKSAKMDVSDWYDSAILGGLEALSSGITCVADITATGAACTATQKLGMRSVIYREVGAMDKRRVDYAMRIAENDIMHWREEVDGDRITIGVAPAAMYACHPSMFSKVSEFARRENVPVAMHVAGNREEYNFIKYGSSPFSVHTMDQKRGFVEIPPWLPTGTTPVRYALNWGAFESDNVLAIHCVHVDDKDVQKLKEYDVAVAVCPRCNAQLGMGVAPINEFMRAGLRLGMGTDSPAATDSTDMLTEMRIGMLVQRAVNVGEFLDSATMLEMATIGGARALKLDDKIGSLEIGKLADIIAVDLSGSHQTPTTDPVSAVVNTCSGADILMTMVNGTALYEKNKWNVGVEVARNIARIIEIRGKLRL GT:EXON 1|1-451:0| BL:SWS:NREP 1 BL:SWS:REP 17->420|MTAD_DESRM|8e-49|31.0|378/433| BL:PDB:NREP 1 BL:PDB:REP 12->442|1p1mA|5e-34|31.2|382/404| RP:PDB:NREP 1 RP:PDB:REP 11->437|1ejsC|3e-36|13.4|389/565| RP:PFM:NREP 1 RP:PFM:REP 266->388|PF01979|4e-08|44.2|95/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 54->388|PF01979|2.9e-45|32.6|270/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 3 RP:SCP:REP 11->84|1onwA1|8e-09|15.1|73/105|b.92.1.7| RP:SCP:REP 56->367|2imrA2|4e-56|23.4|299/306|c.1.9.16| RP:SCP:REP 353->441|2pajA1|2e-14|15.9|88/139|b.92.1.4| HM:SCP:REP 57->372|1j6pA2|3.1e-72|35.3|278/0|c.1.9.9|1/1|Metallo-dependent hydrolases| OP:NHOMO 943 OP:NHOMOORG 594 OP:PATTERN --2-2----------111-----253333121112213222221112122222111122221111-11 --114---------2---------11-----12---134212123----11-311--1----41213221-----111-122411111-----211---------11--1--------------------------22211---2-1------11-----------1111-------------1111111-1--11111111111111133111-111-------------42--------------------2------1-------11----------------1--11111111111-------------1---------11111222121231316--111-1112-1--21111132122311111--1111111-------434--------11111111111-532321541---21121-34224811--1122----32222222222122-------------------------------------211-----1112111----22322112114133522--22211---1---12-41111122---------12111211-2231122221111111111----212311111111111-1-------1-1-1111---111-1---------1--------------1111---------12-11111111111-111111111111111111-131----1----------------1-------1----------------1111111111-13-3---------------111-114-1-23333332433322432221---------2235-----1-11121111111111111--11--11--------------------1-----------------1132211111111 ----11------11111-322324543---111-1-1111111---222334652222222211--1-1-11-2111-111-1-1-11-14-1-2----11--111-1-11131111-11--1-------------1---1--------------131-----1111--1411-1123-5---2121212-11-5444- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 442 STR:RPRED 98.0 SQ:SECSTR EEEEccEEEcEETTEEEEEEEEEETTEEEEEEcEEcTTTccTTcEEEEcTTcEEEEcEEEEEEEcccTTHHHHcccHHHHHTEEEEEEEcccccHHHHHcccccHHHHHHHHHTTcccEEEEEEEcccccHHHHHHHHHHHHHHHTccEEEEGGGcccHHHHHHHHHHHHTcEEEEEccTTcccccHHHHHHHHTTccEEETTTTcTTcccTTTGGGGGGcTTEEEEEEcTTccccHHccTTTGcccccTTTGGGGGGcTTEcccTTHHHHHHHHHHHHTTccTTcHHHHHHHHTTccHHHHHHHHHHHHTTcccEEEccTTccccTTcHHHHHHHHHHHHHHHHcccHHHHHHHHHTTTHHHHHHTTcTTTcccccTTccccEEEEcGGGTTTcccEEEETTEEEEEEEccTTcccccccccEEEEcGGGcHHHHHEEcHH######### DISOP:02AL 451-452| PSIPRED cEEEccEEEEcccccccccEEEEEccEEEEEcccccccccccccEEEEccccEEEEccEEccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccEEEEccccccHHHHHHHHHcccEEEEEHHHHHHHHcccccHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccEEEcccccccEEEEEcccccccccccHHHHHHHccccccEEEEEEccEEEEEccEEcccccHHHHHHHHHHHHHcccc //