[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56786.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56786.1 GT:GENE ACV56786.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3295231..3295596) GB:FROM 3295231 GB:TO 3295596 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56786.1 GB:DB_XREF GI:257476466 LENGTH 121 SQ:AASEQ MTELLLVIIIVQLGFVLNRLHKKGDSAKESVFDRFEREQKGNAVFVASQLRELHGCACAFTLWAPGRIFADESPSTQGRGIILDSDDEWVLIECPAPFGAKGATQRLFRIADIKSVAEIVG GT:EXON 1|1-121:0| TM:NTM 1 TM:REGION 1->21| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-45,67-67,73-74,76-76,81-82,95-95,121-122| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEHHHHHHHHccEEEEEEEcccEEEccccccccccEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHc //