[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56801.1
DDBJ      :             protein of unknown function UPF0079
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  830/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:164 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   26->127 1htwA PDBj 9e-18 37.3 %
:RPS:SCOP  21->145 1fl9A  c.37.1.18 * 3e-10 30.6 %
:HMM:SCOP  21->145 1htwA_ c.37.1.18 * 6.9e-18 29.0 %
:RPS:PFM   10->128 PF02367 * UPF0079 2e-32 52.9 %
:HMM:PFM   10->131 PF02367 * UPF0079 5e-39 50.8 122/123  
:BLT:SWISS 3->144 YDIB_BACSU 2e-28 45.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56801.1 GT:GENE ACV56801.1 GT:PRODUCT protein of unknown function UPF0079 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3316876..3317370) GB:FROM 3316876 GB:TO 3317370 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0079 GB:NOTE PFAM: protein of unknown function UPF0079; KEGG: gbm:Gbem_1263 protein of unknown function UPF0079 GB:PROTEIN_ID ACV56801.1 GB:DB_XREF GI:257476481 InterPro:IPR003442 LENGTH 164 SQ:AASEQ MRKTTSSEATKQLAATLAPYLQAGDVIVLSGDLGAGKTQFVQGVAAGLGVRDQVTSPTFNILLTYPAGSLPLYHFDLYRLEEADELEDIGYYETIDGDGASFVEWGEKFPEALPYGYLEISIRVDDEGNRSVRTHAYGDRARRLLFVWAKDSKSRLMKCAGGTA GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 3->144|YDIB_BACSU|2e-28|45.0|140/158| BL:PDB:NREP 1 BL:PDB:REP 26->127|1htwA|9e-18|37.3|102/158| RP:PFM:NREP 1 RP:PFM:REP 10->128|PF02367|2e-32|52.9|119/123|UPF0079| HM:PFM:NREP 1 HM:PFM:REP 10->131|PF02367|5e-39|50.8|122/123|UPF0079| RP:SCP:NREP 1 RP:SCP:REP 21->145|1fl9A|3e-10|30.6|124/157|c.37.1.18| HM:SCP:REP 21->145|1htwA_|6.9e-18|29.0|124/158|c.37.1.18|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 837 OP:NHOMOORG 834 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111----111111111--1111111111111--11-11---1111111-11111-1111111111111--1111111111111111111111111111-111111111111111111111111111111111-111-111111111111111-111-1111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111-11-11-11111111111111111111111111111111111111111-11-111111111111-1111111111111111----11111111111111111111111111111111111111111111111-1111111111-111111111111111111-1111111-1-111111111111111111-111111-111111---------1-11111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111---11-----1------1--1----1-111111-1111 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------12--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 62.2 SQ:SECSTR #########################EEEEEccTTccHHHHHHHHHHHTTccccccccTTTcEEEEEETTEEEEEEEcTTcccTTHHHHcTHHHHHccccEEEEEcGGGGTTTcccccEEEEEEEETT##################################### PSIPRED cEEcccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccccccEEEEEEEEccccEEEEEEEEEcccHHHHHHcccHHHHccccEEEEEcHHHHHccccccEEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHccHHHHHHHccccc //