[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56804.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  271/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:208 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   51->98 2ivfB PDBj 1e-07 39.6 %
:RPS:PDB   51->99 1bc6A PDBj 1e-07 34.7 %
:RPS:SCOP  8->174 1kqfB1  d.58.1.5 * 3e-17 27.7 %
:HMM:SCOP  1->198 1q16B_ d.58.1.5 * 1.6e-34 34.3 %
:HMM:PFM   6->22 PF00037 * Fer4 8.1e-06 52.9 17/24  
:HMM:PFM   59->68 PF00037 * Fer4 0.00034 70.0 10/24  
:HMM:PFM   76->97 PF00037 * Fer4 1.2e-11 50.0 22/24  
:HMM:PFM   149->159 PF00037 * Fer4 7.7e-05 54.5 11/24  
:BLT:SWISS 1->168 HYFA_ECOLI 5e-38 45.5 %
:PROS 82->93|PS00198|4FE4S_FER_1
:REPEAT 2|8->68|78->159
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56804.1 GT:GENE ACV56804.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3319537..3320163) GB:FROM 3319537 GB:TO 3320163 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: sbc:SbBS512_E2853 hydrogenase-4 component A GB:PROTEIN_ID ACV56804.1 GB:DB_XREF GI:257476484 InterPro:IPR001450 InterPro:IPR017900 LENGTH 208 SQ:AASEQ MNRFVVSDPSRCIGCSACRVTCTESHRRRALRPASRISLVKTRTVSAAVTCHQCEGAPCMTVCPEGAIVQERDRLHVDESRCTGCLLCALVCPFGAVYPSAPSTAHVKAAPYSRASSARSAGLLRQKETGAYTSVVMCDLCAKSPNGPRCVEACPTKALALVDEGMLEALGRTRRIEAIEMTDIAMRGALGADLAVRVDALFDREGDA GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 1->168|HYFA_ECOLI|5e-38|45.5|167/205| PROS 82->93|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|8->68|78->159| SEG 109->121|aapysrassarsa| BL:PDB:NREP 1 BL:PDB:REP 51->98|2ivfB|1e-07|39.6|48/337| RP:PDB:NREP 1 RP:PDB:REP 51->99|1bc6A|1e-07|34.7|49/77| HM:PFM:NREP 4 HM:PFM:REP 6->22|PF00037|8.1e-06|52.9|17/24|Fer4| HM:PFM:REP 59->68|PF00037|0.00034|70.0|10/24|Fer4| HM:PFM:REP 76->97|PF00037|1.2e-11|50.0|22/24|Fer4| HM:PFM:REP 149->159|PF00037|7.7e-05|54.5|11/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 8->174|1kqfB1|3e-17|27.7|141/244|d.58.1.5| HM:SCP:REP 1->198|1q16B_|1.6e-34|34.3|169/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 1017 OP:NHOMOORG 317 OP:PATTERN --1111-11111112-2-311114---1---11-433333231-1--13-21222114151---3--- --21----------------------------------1-----------------------11-----1---------3M7223111-------------------------------------1132122222222222111-1------------------------------------------1-----------------------------------1--------------------------------------------------------------------------------------------------122-2-----------211-111--1--4----EE1123-2691113----21------------------31--------------11111-11-1------------1-------------211-------------4-3------------------------------------11-1-------------1---------11111-111122-22-2122--1-1-1--1----------33--16-4213253221112-21321-1-1-----24222112211---------25211--43---------33533-2843245366472----32-------525564-AAA9A999AA-9A9B999A9AA9A8AAAA644453--2757677777776766626658889--222222222222----------------1-111221111111-11----------1----------------------------1222-----23123--------------------------------------------------------------1---------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 78.4 SQ:SECSTR ###EEEEGGGGccccTTcccTTccccTTTccccccccccHHHHHHHHHHHTTTccccccTTTcTTccEEEccccEEEcTTTccccccHHHHcGGGccEEGcTTGGGTTccE#########ccEGGGGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGGGccc################################# PSIPRED ccEEEEEEccccccccHHHHHHHHHHccccccEEcccEEEcccEEEEEccccccccccHHHHccccccccccccEEEcHHHcccccccHHHcccccEEEcccccccHHccccccccccccccccccccccEEEEEEEcHHHHHccccccHHHHcccccEEEccHHHHHHHHHHHHHHHHccccccccccccccccEEEEHHHcccccc //