[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56809.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:219 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 56->118 F16A2_HALMA 2e-04 40.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56809.1 GT:GENE ACV56809.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3324883..3325542) GB:FROM 3324883 GB:TO 3325542 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56809.1 GB:DB_XREF GI:257476489 LENGTH 219 SQ:AASEQ MKPVSNGAKAVFAVAFALFLAVVLVGIALSDNPVKKFFKQQEVLDIAKMHMSQVKSGEVYTGALQFADDIDFDNLALSQVIPMYSARQNGDVVRDESEGYAVYSNGKVVALFGIYKCDPGAVTGGTTMSNVGLEVVQNMLSDPGTCALLQPCDSSGALYVTPHSSEAVEVFDPGPSFPGEPPEPPPAPETVTLESVGITSEMISQIDFPEHQDPVPFSV GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 56->118|F16A2_HALMA|2e-04|40.3|62/100| TM:NTM 1 TM:REGION 9->31| SEG 10->25|avfavafalflavvlv| SEG 173->189|pgpsfpgeppepppape| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-40,45-46,48-48,53-54,59-59,62-62,199-199,219-220| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHcccccccccccEEEEccccEEEEEcccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEcccccEEEEEccccccccccccccccccEEEEEEccccHHHHHHcccccccccccccc //