[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56813.1
DDBJ      :             histidine kinase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  831/915 : Eukaryota  89/199 : Viruses  1/175   --->[See Alignment]
a.26.1a.30.2d.122.1
:305 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   77->298 3dgeA PDBj 3e-21 25.7 %
:RPS:PDB   76->298 3d36B PDBj 4e-31 22.0 %
:RPS:SCOP  24->141 1csgA  a.26.1.2 * 1e-13 10.4 %
:RPS:SCOP  147->298 1bxdA  d.122.1.3 * 6e-21 24.7 %
:HMM:SCOP  61->147 2c2aA1 a.30.2.1 * 7.2e-19 35.6 %
:HMM:SCOP  148->302 2c2aA2 d.122.1.3 * 1.6e-41 39.4 %
:RPS:PFM   87->143 PF00512 * HisKA 9e-09 56.1 %
:RPS:PFM   191->298 PF02518 * HATPase_c 1e-10 34.3 %
:HMM:PFM   189->298 PF02518 * HATPase_c 8.3e-28 40.4 109/111  
:HMM:PFM   81->144 PF00512 * HisKA 2.7e-22 51.6 64/68  
:HMM:PFM   5->65 PF00672 * HAMP 3.4e-06 23.7 59/70  
:BLT:SWISS 40->298 CUSS_ECO57 1e-25 30.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56813.1 GT:GENE ACV56813.1 GT:PRODUCT histidine kinase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3329455..3330372 GB:FROM 3329455 GB:TO 3330372 GB:DIRECTION + GB:PRODUCT histidine kinase GB:NOTE PFAM: ATP-binding region ATPase domain protein; histidine kinase A domain protein; SMART: ATP-binding region ATPase domain protein; histidine kinase A domain protein; KEGG: gbm:Gbem_1864 multi-sensor signal transduction histidine kinase GB:PROTEIN_ID ACV56813.1 GB:DB_XREF GI:257476493 InterPro:IPR003594 InterPro:IPR003661 InterPro:IPR004358 InterPro:IPR005467 InterPro:IPR008358 LENGTH 305 SQ:AASEQ MLLAPVGLVVFTFSLIIGHFISEPLRLLAKKTAAYRTGTDVPFEPDGRLYEADQLSADFKALVQTTKSQQHDLVLKERRQAAFISDVAHELRTPLTAIRGNAEMLEDPDLPPELHEKFCSIIIAESERLSRLTHDLLTLQRIDDNAMPMELSRVNLRELATGVLDALEPILRDRHANTEIVGEAPDVLGDPDRLKQAVTNLVENASRFIEPDGHITIELFGLKGNSILAVKDDGTGFGDIDPQLLFDRFYRTDASRSRGTGGTGLGLAIVKSVVESHDGTVEAINLPDGGACFIIALPSILPGER GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 40->298|CUSS_ECO57|1e-25|30.3|251/482| TM:NTM 1 TM:REGION 4->26| SEG 254->268|asrsrgtggtglgla| BL:PDB:NREP 1 BL:PDB:REP 77->298|3dgeA|3e-21|25.7|222/237| RP:PDB:NREP 1 RP:PDB:REP 76->298|3d36B|4e-31|22.0|214/221| RP:PFM:NREP 2 RP:PFM:REP 87->143|PF00512|9e-09|56.1|57/69|HisKA| RP:PFM:REP 191->298|PF02518|1e-10|34.3|105/112|HATPase_c| HM:PFM:NREP 3 HM:PFM:REP 189->298|PF02518|8.3e-28|40.4|109/111|HATPase_c| HM:PFM:REP 81->144|PF00512|2.7e-22|51.6|64/68|HisKA| HM:PFM:REP 5->65|PF00672|3.4e-06|23.7|59/70|HAMP| GO:PFM:NREP 4 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF00512|IPR003661| GO:PFM GO:0007165|"GO:signal transduction"|PF00512|IPR003661| GO:PFM GO:0016020|"GO:membrane"|PF00512|IPR003661| GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 2 RP:SCP:REP 24->141|1csgA|1e-13|10.4|115/120|a.26.1.2| RP:SCP:REP 147->298|1bxdA|6e-21|24.7|146/161|d.122.1.3| HM:SCP:REP 61->147|2c2aA1|7.2e-19|35.6|87/0|a.30.2.1|1/1|Homodimeric domain of signal transducing histidine kinase| HM:SCP:REP 148->302|2c2aA2|1.6e-41|39.4|155/0|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 10100 OP:NHOMOORG 946 OP:PATTERN -----------------------17-1-3525--11-12222416-167EE38--------------3 9LW4H356777644A7855-5D4488566566C778496889966764565568C45711A8L4B59GFF7444465554E9811323QOiO-Q211--85G69AXAWQU---------1----2323A3436374caYPOG7Bc3jNaiQQABB88333543GIAVilxE332332242322GE933232D9BOOPOQONPIQPRQSMDFAAB8PRU9BCJ7LG988988iX6666666666666665555376766664535665576555565464AAA544433333333333333333333333433331111111165VFHgMMLPOOPNNKDMPO8BC9MGF55ABHC5VQLEB735756574216EAITTTH33444CBKEGFA8FHGDI66666665668-KJMILFMH8EG1GHHJEEDHGGCBCCAAGB5887787F93333333354356gIH11111111--12111111211111111112488435BAABOJKOPOH9AA7LLPREEEF7CRNRJMNR12IMGNFJ88QMJFJ49FN8D8AH8222222235FCOsQQPE9AVB5yTLIH3kUgjdjYEGaTmWo*5L21-11-------1-------6432555BB7KHJD7OJADA8ABBDB998CEABECFF--276DC------DEBCBCAHGGIGIGJGH-GJIGHHHGGHGHHGHHHHGIIIAC997GEEGFFGFFGGGGGGGGFE9EDFH4-BCCDEEEBCEEE--375555567668Ab8K222223-111121127877945576EGIIMJJUOXHNNQKKIJM2222133129DDCFBCCCCIJHJKKLKGJHEEGG6535--n1GG89BB--------2-1-------------------------3A534343432S4 --1-48--------63332334233433333233333444343222-233212323222232-----1------------------22-1213131--11232236-6--------------------------------------------------2----2---------1--23-A--1-1H35A34B1-8111- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- STR:NPRED 289 STR:RPRED 94.8 SQ:SECSTR ################HHHHHHHHHHHHTTccHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHTccccccEEEEHHHHHHHHHHHHHHHHHHTTEEEEEEccccEEEEcHHHHHHHHHHHHHHHHHTcTTcEEEEEEEEEETTEEEEEEEEccccccHHHHHHTTcTTcccccccTHGGGccccHHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEETTcHHHH PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEcHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEEccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccc //