[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56818.1
DDBJ      :             Electron transfer flavoprotein alpha subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  543/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.26.2c.31.1
:305 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   93->302 1efpA PDBj 4e-22 29.5 %
:RPS:PDB   38->305 1efvA PDBj 3e-24 25.3 %
:RPS:SCOP  10->203 1efpB  c.26.2.3 * 4e-11 20.3 %
:RPS:SCOP  186->304 1efpA2  c.31.1.2 * 6e-35 37.3 %
:HMM:SCOP  4->181 1o97D1 c.26.2.3 * 8.9e-20 27.7 %
:HMM:SCOP  184->306 1o97D2 c.31.1.2 * 5.6e-38 41.8 %
:RPS:PFM   14->128 PF01012 * ETF 1e-05 34.8 %
:RPS:PFM   185->270 PF00766 * ETF_alpha 2e-10 38.8 %
:HMM:PFM   185->270 PF00766 * ETF_alpha 9.4e-30 42.4 85/86  
:HMM:PFM   11->150 PF01012 * ETF 1.8e-19 27.3 139/164  
:BLT:SWISS 8->304 FIXB_ECO5E 1e-52 37.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56818.1 GT:GENE ACV56818.1 GT:PRODUCT Electron transfer flavoprotein alpha subunit GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3332454..3333371) GB:FROM 3332454 GB:TO 3333371 GB:DIRECTION - GB:PRODUCT Electron transfer flavoprotein alpha subunit GB:NOTE PFAM: Electron transfer flavoprotein alpha subunit ; Electron transfer flavoprotein alpha/beta-subunit; KEGG: slo:Shew_2678 electron transfer flavoprotein, alpha subunit GB:PROTEIN_ID ACV56818.1 GB:DB_XREF GI:257476498 InterPro:IPR014730 InterPro:IPR014731 LENGTH 305 SQ:AASEQ MSDKTIAVFADTAEAYEELCSGARALGGRPVALWAGDEADAQRIAAWGARVMHVGAVPEGALYEDCVPAFQEVVQAEQPTLILARMSKRTQCVAGRLAVRLGVPVVTDASRVKLDDEGVEAAHMAYGGAAERVEHARGMAIVLVGSGVFEIDEAPAAGTVERAAASIEPGPIKLVGRQEKQEEVVDLGSAKVVVCVGRGIQNKQNLGKAQEYAARIGGETACTRPIAEGEGWMAHSRYLGVSGAVVKPDVYIGLGVSGQVQHTVGMAESQFVVAVNKDKNAPLMKHCDLGLVADLEKVLPVLAAL GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 8->304|FIXB_ECO5E|1e-52|37.4|297/313| BL:PDB:NREP 1 BL:PDB:REP 93->302|1efpA|4e-22|29.5|207/307| RP:PDB:NREP 1 RP:PDB:REP 38->305|1efvA|3e-24|25.3|265/312| RP:PFM:NREP 2 RP:PFM:REP 14->128|PF01012|1e-05|34.8|115/157|ETF| RP:PFM:REP 185->270|PF00766|2e-10|38.8|85/86|ETF_alpha| HM:PFM:NREP 2 HM:PFM:REP 185->270|PF00766|9.4e-30|42.4|85/86|ETF_alpha| HM:PFM:REP 11->150|PF01012|1.8e-19|27.3|139/164|ETF| RP:SCP:NREP 2 RP:SCP:REP 10->203|1efpB|4e-11|20.3|192/246|c.26.2.3| RP:SCP:REP 186->304|1efpA2|6e-35|37.3|118/124|c.31.1.2| HM:SCP:REP 4->181|1o97D1|8.9e-20|27.7|177/0|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 184->306|1o97D2|5.6e-38|41.8|122/0|c.31.1.2|1/1|DHS-like NAD/FAD-binding domain| OP:NHOMO 1197 OP:NHOMOORG 739 OP:PATTERN 22----2222222222-22322212112-111-----------------------------3322--- 1232211111111111111-11111111111111111121111111-11---111112--11211111121--------152------11111122---111111111-1---------------1111111112111122---12-------11-----------1----------------11111--112111111-1111111111111111111131111------21----------------------1--------11---------------------------------------------------------1532555555554541433422215-3-1-12-973463-141--11-3-12-111111111322221112222211111111111-2222242212113112334335233411111111111112222222212212322-----------------------------1121113321222233312222223722221245612121112261222231212111-112111111111---14115421----------7471915--11211114-------------------------1111-1112121-1111111311112132121-----1-------1-1-1--3222333332-2333333333233333331-------13231333332313113-2213222-----------------1111111111-1124---------------11111111114122222222222221223-------------1-----11-1111111111111111--12111111----------1-------------------------11111121111-- ----111-211-11111111111111111111111111111111111-111111111-1111111111--1111111111111111-1-12111111111111112-11121211-11-1--1111-1-221-12211--1-11111-1-11-2121-11211211121131111111------111321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 98.4 SQ:SECSTR #####ccccccHHHHHHHHHHHcccTTcEEEEEEEcTEcccHHHHHHHHHEEEEcGGGTTccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHTcccEEEEcEEEETTEEEEEETTTTTTEEEEEEcccccEEEEEGGGcccccccccccEEEEccccccccccccccccccccccccGGGccEEEEEcGGGccTGGGHHHHHHHHHHTcEEEEcHHHHHTTTcccGGGcccTTcccccccEEEEEcccccHHHHTTTTTccEEEEEEccTTcGGGGTccEEEEccHHHHHHHHHHH PSIPRED cccccEEEEEEcHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccEEEEEcccccccEEEEEEEEccccccccccccEEEEEccccccHHHHHHHHHHHHHHccEEEccHHHHHHcccccHHHEEcccccEEccEEEEEEEEcccHHHHHccccccEEEEEEccccccHHccccEEEEccHHHHHHHHHcc //