[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56844.1
DDBJ      :             DNA binding domain protein, excisionase family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->43 MTS1_SALIN 6e-07 39.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56844.1 GT:GENE ACV56844.1 GT:PRODUCT DNA binding domain protein, excisionase family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3367462..3367845 GB:FROM 3367462 GB:TO 3367845 GB:DIRECTION + GB:PRODUCT DNA binding domain protein, excisionase family GB:NOTE TIGRFAM: DNA binding domain protein, excisionase family; KEGG: acp:A2cp1_1062 DNA binding domain protein, excisionase family GB:PROTEIN_ID ACV56844.1 GB:DB_XREF GI:257476524 InterPro:IPR010093 LENGTH 127 SQ:AASEQ MLSVVESAEILQVTPTRVRALIAQGALPAQKVGRTWTLREEDVMQRAATRPSAGRPRKADVPSPADDSKPHAAASELYRACKDHLAACPSAAEIAAIDDPEQAAFRIAVADFFLQRKQSELVRQGVF GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 1->43|MTS1_SALIN|6e-07|39.5|43/461| SEG 86->96|aacpsaaeiaa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-60,73-73,81-81,87-88,90-90,95-95,101-101,109-109,115-115,118-118| PSIPRED cEEEEcHHHHHHHcHHHHHHHHHcccccHHHcccEEEEEHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //