[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56853.1
DDBJ      :             LrgA family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:RPS:PFM   56->143 PF03788 * LrgA 2e-08 33.0 %
:HMM:PFM   52->143 PF03788 * LrgA 2.9e-27 38.0 92/96  
:BLT:SWISS 45->146 YOHJ_ECO5E 1e-11 46.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56853.1 GT:GENE ACV56853.1 GT:PRODUCT LrgA family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3377879..3378382 GB:FROM 3377879 GB:TO 3378382 GB:DIRECTION + GB:PRODUCT LrgA family protein GB:NOTE PFAM: LrgA family protein; KEGG: efe:EFER_2226 conserved hypothetical protein; putative inner membrane protein GB:PROTEIN_ID ACV56853.1 GB:DB_XREF GI:257476533 InterPro:IPR005538 LENGTH 167 SQ:AASEQ MKQQTDAVSGVSGCASAPAHGDVSWRAKAGRAGKRGARFAAQLALVVAVYGAGCAIASVLPVRLPGNIVGMVLLLVLLGTGLLKARHVGDACDCLLDNMSLFFIPAGVAIMGCVSLLEGNALKFALVCVITTVIVFLATSYTVMLVSRLTAKRVDATGVARVADEEA GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 45->146|YOHJ_ECO5E|1e-11|46.1|102/132| TM:NTM 4 TM:REGION 37->59| TM:REGION 63->84| TM:REGION 93->115| TM:REGION 125->147| SEG 26->41|rakagragkrgarfaa| SEG 69->83|vgmvlllvllgtgll| RP:PFM:NREP 1 RP:PFM:REP 56->143|PF03788|2e-08|33.0|88/96|LrgA| HM:PFM:NREP 1 HM:PFM:REP 52->143|PF03788|2.9e-27|38.0|92/96|LrgA| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03788|IPR005538| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN ---------------------------------------------------1---------------- -------------------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-111-11-111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------11-----1--1---------1-------1-----1---1-----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHcccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //