[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56857.1
DDBJ      :             zinc/iron permease
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  266/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
:264 amino acids
:PSIPRED
:RPS:PFM   96->258 PF02535 * Zip 3e-15 39.6 %
:HMM:PFM   14->95 PF02535 * Zip 8.8e-08 26.8 82/319  
:HMM:PFM   98->259 PF02535 * Zip 1.2e-20 26.5 151/319  
:BLT:SWISS 97->264 S39AB_XENTR 4e-35 47.3 %
:TM
:REPEAT 2|121->158|159->207
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56857.1 GT:GENE ACV56857.1 GT:PRODUCT zinc/iron permease GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3380939..3381733) GB:FROM 3380939 GB:TO 3381733 GB:DIRECTION - GB:PRODUCT zinc/iron permease GB:NOTE PFAM: zinc/iron permease; KEGG: dps:DP0096 GufA protein GB:PROTEIN_ID ACV56857.1 GB:DB_XREF GI:257476537 InterPro:IPR003689 LENGTH 264 SQ:AASEQ MQTALLWAAGGTGFTFLMTTLGAASVFLFRKRNSMVFQRIFLGFAAGVMIAASVWSLLIPAIERAEEAGQVGWIPAAGGFAIGVAFLMVLHQLLPHLHPGESKPEGLPSKWDRPTLLFTAVTLHNIPEGMSVGLLFAMAAQNGGDPAMFGMAVALAIGIGIQNVPEGAAVALPMLQEGMSAPKAFALGALSGLAEPVFGILVVLFAGLISPYMPWMLAFSAGAMMYVVVEELIPEAHLGEHSNAGTLGVMAGFLVMMILDVALG GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 97->264|S39AB_XENTR|4e-35|47.3|165/336| TM:NTM 6 TM:REGION 6->28| TM:REGION 39->61| TM:REGION 75->97| TM:REGION 134->156| TM:REGION 186->208| TM:REGION 242->264| NREPEAT 1 REPEAT 2|121->158|159->207| SEG 10->22|ggtgftflmttlg| RP:PFM:NREP 1 RP:PFM:REP 96->258|PF02535|3e-15|39.6|149/299|Zip| HM:PFM:NREP 2 HM:PFM:REP 14->95|PF02535|8.8e-08|26.8|82/319|Zip| HM:PFM:REP 98->259|PF02535|1.2e-20|26.5|151/319|Zip| GO:PFM:NREP 4 GO:PFM GO:0016020|"GO:membrane"|PF02535|IPR003689| GO:PFM GO:0030001|"GO:metal ion transport"|PF02535|IPR003689| GO:PFM GO:0046873|"GO:metal ion transmembrane transporter activity"|PF02535|IPR003689| GO:PFM GO:0055085|"GO:transmembrane transport"|PF02535|IPR003689| OP:NHOMO 507 OP:NHOMOORG 385 OP:PATTERN 111-1-----------1-11-11-21121221--1---11111-----1-211-1111111---1--- -------1111-----------------------------------1------1--1---------------------1-1121-111------------1--11---1----------------1-111111--2---------11-1----11-----------1-1----------------111--1-1-------------------------11111111111111-1---------------1111-----------------------------1----11------------------------11111-1111133--222222222121------122111111-111--1221-111-1---11---2-------1---------------------------------------------------2-------------------------------------------------------------2122-----------------------------------1--1--------11------11111----1-111111111112211-----1-11----2-1------1111------------1-----111----2-----------------------------------11--11-1111111111-1111111111111111111111-----111111111111111111111111-----------------1---------2--1-1111-----------------1---1211112221-22221111------------------------111-1------------111----11111111--1-------------------------1111111111--1 ----112-----111---------------------------------------------------------------------------------------------622-111-1111111131121151-111111-11131-111-11---111111-1211-14131121-2125222322233-326476963 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcc //