[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56858.1
DDBJ      :             Integrase catalytic region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  464/915 : Eukaryota  3/199 : Viruses  3/175   --->[See Alignment]
c.55.3
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->139 2e94B PDBj 7e-04 14.4 %
:RPS:PDB   124->284 1bisB PDBj 4e-14 16.7 %
:RPS:SCOP  124->278 1b92A  c.55.3.2 * 3e-13 12.4 %
:HMM:SCOP  116->285 1c0mA2 c.55.3.2 * 6.9e-29 25.9 %
:HMM:PFM   121->237 PF00665 * rve 3.8e-19 24.8 117/120  
:HMM:PFM   7->28 PF09339 * HTH_IclR 0.00015 45.5 22/52  
:HMM:PFM   235->258 PF03108 * MuDR 0.001 45.8 24/67  
:BLT:SWISS 8->281 INSK_ECOLI 7e-50 38.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56858.1 GT:GENE ACV56858.1 GT:PRODUCT Integrase catalytic region GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3382024..3382878) GB:FROM 3382024 GB:TO 3382878 GB:DIRECTION - GB:PRODUCT Integrase catalytic region GB:NOTE PFAM: Integrase catalytic region; KEGG: apj:APJL_1896 transposase GB:PROTEIN_ID ACV56858.1 GB:DB_XREF GI:257476538 InterPro:IPR001584 LENGTH 284 SQ:AASEQ MIEMLSGQGHALSDLLAAAGLPRSTYYRARSHPPRPTRPELWEKVAEVFSRTANGCGHRQVAMALRAEEDVAIADKTALKIMHEMGISCGIRRESDYHRYNSFKGVVGRAFDNVLDRDFSADEPWQKLGTDVTEFKAPWGRAYFAPAYDFGSKEIVSWSISRSANMAQQKEMLEGLLAKMPEAASPVMHSDMGWQYQHDGYCKTLEEAGIVQSMSRKGNCIDNGATEQVFGHIKDEFFRGQSFESFEEFKERLEAYIVHWNTRRRQVKLKGLTPEEFRNQSLAA GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 8->281|INSK_ECOLI|7e-50|38.7|269/283| RP:PDB:NREP 2 RP:PDB:REP 9->139|2e94B|7e-04|14.4|125/306| RP:PDB:REP 124->284|1bisB|4e-14|16.7|150/154| HM:PFM:NREP 3 HM:PFM:REP 121->237|PF00665|3.8e-19|24.8|117/120|rve| HM:PFM:REP 7->28|PF09339|0.00015|45.5|22/52|HTH_IclR| HM:PFM:REP 235->258|PF03108|0.001|45.8|24/67|MuDR| RP:SCP:NREP 1 RP:SCP:REP 124->278|1b92A|3e-13|12.4|137/144|c.55.3.2| HM:SCP:REP 116->285|1c0mA2|6.9e-29|25.9|162/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 3373 OP:NHOMOORG 470 OP:PATTERN -------------------------------------------------------------------- 1-HI-FCG--1K-C1G-11-1A--13G4HHE-D687-2A5--133--3-----1--3*---25---61-2-4---87-1-47-----1--8----------3-6-462--------------------62---3--------4---81----------------1-3----------------5--------64----362787C686B-5992-841-32414-2--2-261211-6----11-1-2-1--4-6--B7-G-6-21227-851222OlN541CBi9-751515565344332212333243262--BDB------7-41121111-8-R-11---139I-2--2--9421143--1-1---8-13BE----------B3312------22222222222-4-1----8111--441---2--12-4-1-2-2---B2--BBBBBBBB-33A-B---------------------1-------------------U4--D855111-GF452232---9C-1-G-283967D36128--57121-11--24-111-CK34-4--312--B---------25-1-3-----2------------------------D----2-J337-83--31MAJ489-11-41nAA731----25--------1111226MOA62B75D-N965B581u5P4ABB5CB3515--71-151---1-323-2--36*e*****--F89739887-3----------5--141--99A9-15-134-1-----51--5A9H6822911--1-241-487E---------42---65645M1115D3K8H79335------9-----94----------18981------5------D--3-11----8--------- -----------------------------------------------------------------------------------------------------------------------------------------------3--------------------------1-----------------2---------- ------------------------------------------------------------1-----------------------------------------------------------------------------------------1-----1------------------ STR:NPRED 270 STR:RPRED 95.1 SQ:SECSTR ########cHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHccccccHHHHHH######HHHHHHcTTTEEEEEEEcTTEEEEEEEEEGGGTTTEEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHccccEcccEEEccccTTTccHHHHHHHHHHTcEEEccccccccHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHccGGGcccccHHHHHHHHHHH DISOP:02AL 284-285| PSIPRED cHHHHHHccccHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHcccEEEEEEEEEEEccccEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHccc //