[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56866.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  385/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   94->229 1kqfB PDBj 1e-15 34.4 %
:RPS:PDB   150->221 1bc6A PDBj 4e-10 25.7 %
:RPS:SCOP  72->239 1kqfB1  d.58.1.5 * 6e-25 24.6 %
:HMM:SCOP  83->241 1q16B_ d.58.1.5 * 5.9e-36 35.2 %
:HMM:PFM   92->108 PF00037 * Fer4 0.00021 41.2 17/24  
:HMM:PFM   159->170 PF00037 * Fer4 0.00057 58.3 12/24  
:HMM:PFM   179->199 PF00037 * Fer4 2.5e-10 47.6 21/24  
:HMM:PFM   210->228 PF00037 * Fer4 9.3e-10 63.2 19/24  
:HMM:PFM   41->66 PF10399 * UCR_Fe-S_N 0.0002 26.9 26/41  
:BLT:SWISS 76->235 YDHY_SHIFL 7e-41 44.4 %
:PROS 185->196|PS00198|4FE4S_FER_1
:PROS 212->223|PS00198|4FE4S_FER_1
:TM
:REPEAT 2|172->196|203->223
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56866.1 GT:GENE ACV56866.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3390445..3391206) GB:FROM 3390445 GB:TO 3391206 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: sbo:SBO_1458 hypothetical protein GB:PROTEIN_ID ACV56866.1 GB:DB_XREF GI:257476546 InterPro:IPR001450 InterPro:IPR006311 InterPro:IPR017900 LENGTH 253 SQ:AASEQ MSDSNLNQNTSEDTSFPAAAPETNASAPAPQSAGPEEEPKQKTFTRRTVLAMAGCGVAGLVVGGVLASWGVTSASIASGRIEIRTTPTKMIVTDRARCSGCQRCEMMCTLKNDGRVCQHIARVRVWPNYNFGASVDTKDGIYDNCEFTVEHCKQCADPACMNYCPVHAIYADEESGARTVDTKKCIGCGMCSQACPWNMPRVDSETGVSTKCISCGRCAEQCPNGAIKFIDWEDIAQKVIDQGVVRTTTLVQA GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 76->235|YDHY_SHIFL|7e-41|44.4|160/208| PROS 185->196|PS00198|4FE4S_FER_1|PDOC00176| PROS 212->223|PS00198|4FE4S_FER_1|PDOC00176| TM:NTM 1 TM:REGION 48->70| NREPEAT 1 REPEAT 2|172->196|203->223| SEG 17->30|paaapetnasapap| SEG 49->71|vlamagcgvaglvvggvlaswgv| BL:PDB:NREP 1 BL:PDB:REP 94->229|1kqfB|1e-15|34.4|131/289| RP:PDB:NREP 1 RP:PDB:REP 150->221|1bc6A|4e-10|25.7|70/77| HM:PFM:NREP 5 HM:PFM:REP 92->108|PF00037|0.00021|41.2|17/24|Fer4| HM:PFM:REP 159->170|PF00037|0.00057|58.3|12/24|Fer4| HM:PFM:REP 179->199|PF00037|2.5e-10|47.6|21/24|Fer4| HM:PFM:REP 210->228|PF00037|9.3e-10|63.2|19/24|Fer4| HM:PFM:REP 41->66|PF10399|0.0002|26.9|26/41|UCR_Fe-S_N| RP:SCP:NREP 1 RP:SCP:REP 72->239|1kqfB1|6e-25|24.6|167/244|d.58.1.5| HM:SCP:REP 83->241|1q16B_|5.9e-36|35.2|159/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 1867 OP:NHOMOORG 441 OP:PATTERN 22121211122111114-2363351113--124-222132111-1--22-1-122115262---3--- -671---------1-------------------111--1---------1-----------11111---11---------4YQ122122---1-----------------------------------22232222222211332-3------------------------------------------211---------------------------------1------1--------------------------------------------------------------------------------------------33--1111111-1--211-111--1--9-21-fd1345-7A911-11---621--1------2-----3-22--11111111112---1--1-2-1-------------121-1-112-1--3-1111111113----4-1-----------------------------------122-22112122222233223333-22222122-1121241443214211122---13----------734-6712386366337164565452-4463-223-5312112211-1-------19332--52-111-----46997-5G8A9687BA7K7----62-------B5B889-DEEDDDCCDD-EDDECDCDCDEDDBDDDD77887521BEDDEFFFFFFEDFDEE59A8CBCC--344444434444---1---------1111-444434133232114-------1-11-22221-1--11114-------------1223-----3311222-------------12--------------------------------------------21--11111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 66.0 SQ:SECSTR ###############################################################################EcEEEcTTTccEEEccGGGGcccccTTcccTTcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcTTTTccccccTTTcTTccEEEccHHccEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHHHHHHTGGGccccEEEEccccGHHHHcTTcE####### DISOP:02AL 9-14,17-18| PSIPRED cccccccccccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccccccEEEcccccccccccccccccccEEEEHHHcccccccccEEcccccccEEEcccccEEEcccccccHHHHHHHcccccEEEccccccEEEccccccHHHHcccccEEEEEHHHHHHHHHHHHcccccccccc //