[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56871.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:421 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   35->93 2o01C PDBj 4e-06 51.1 %
:RPS:PDB   14->91 3bk7A PDBj 7e-07 29.0 %
:RPS:SCOP  15->93 2v4jB1  d.58.1.5 * 1e-06 21.7 %
:HMM:SCOP  35->393 1q16B_ d.58.1.5 * 1.5e-15 38.9 %
:HMM:PFM   35->47 PF00037 * Fer4 1.5e-05 61.5 13/24  
:HMM:PFM   75->96 PF00037 * Fer4 6.9e-11 45.5 22/24  
:HMM:PFM   334->350 PF00037 * Fer4 2.7e-06 47.1 17/24  
:HMM:PFM   369->391 PF00037 * Fer4 5.3e-07 39.1 23/24  
:HMM:PFM   175->242 PF02662 * FlpD 1.8e-06 23.5 68/124  
:BLT:SWISS 35->92 FWDF_METJA 1e-07 53.2 %
:PROS 81->92|PS00198|4FE4S_FER_1
:PROS 346->352|PS00261|GLYCO_HORMONE_BETA_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56871.1 GT:GENE ACV56871.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 3397362..3398627 GB:FROM 3397362 GB:TO 3398627 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: aeh:Mlg_0217 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein GB:PROTEIN_ID ACV56871.1 GB:DB_XREF GI:257476551 InterPro:IPR001450 InterPro:IPR001545 InterPro:IPR017900 LENGTH 421 SQ:AASEQ MPNLIDIAQRLAERPMVALLHEERCLPERDLGSTCTRCAEACPVDAIAVGLERDTEASPAAAYGSVAKNGPAGPRIDDDACVRCGRCVTACPTAALLAIAPLDDDALLEASVRAGAAAAKRAAGFAAEEAEGQGDSIGTRDAEAQVEAPQAAVAPACAGFACERAVRAGHIDAERTVALPCLAWVDEALIVHMARAGARRILLLTAPCASCEHAKAVVDLPKTVRSAQRILDTWQLDAAASIVETVDDVAASEDEDAAGEVSRRGLFSQARSALVEAATDAASAQMDALTGRSATDAPAPEPDRRRWQLLDDLHAAGLPAGDAVVPRALAPRVDIDPERCSGCALCAGFCLTKALRKAGKAPGGRTLLEFDAALCRDCGTCTDTCRYGAISREETLTVSELFALEPRAIVIPKRRVLPSRR GT:EXON 1|1-421:0| BL:SWS:NREP 1 BL:SWS:REP 35->92|FWDF_METJA|1e-07|53.2|47/355| PROS 81->92|PS00198|4FE4S_FER_1|PDOC00176| PROS 346->352|PS00261|GLYCO_HORMONE_BETA_1|PDOC00234| SEG 94->134|aallaiapldddalleasvragaaaakraagfaaeeaegqg| SEG 142->156|aeaqveapqaavapa| SEG 243->261|vetvddvaasededaagev| SEG 277->288|aatdaasaqmda| SEG 375->386|crdcgtctdtcr| BL:PDB:NREP 1 BL:PDB:REP 35->93|2o01C|4e-06|51.1|47/80| RP:PDB:NREP 1 RP:PDB:REP 14->91|3bk7A|7e-07|29.0|62/593| HM:PFM:NREP 5 HM:PFM:REP 35->47|PF00037|1.5e-05|61.5|13/24|Fer4| HM:PFM:REP 75->96|PF00037|6.9e-11|45.5|22/24|Fer4| HM:PFM:REP 334->350|PF00037|2.7e-06|47.1|17/24|Fer4| HM:PFM:REP 369->391|PF00037|5.3e-07|39.1|23/24|Fer4| HM:PFM:REP 175->242|PF02662|1.8e-06|23.5|68/124|FlpD| RP:SCP:NREP 1 RP:SCP:REP 15->93|2v4jB1|1e-06|21.7|60/69|d.58.1.5| HM:SCP:REP 35->393|1q16B_|1.5e-15|38.9|108/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 19.0 SQ:SECSTR #############ccEEEEccGGGccTTcccTccccHHHHHcHHHHTTcccEEEETTTTEccEEEEEccccEEEEEcTTTcccccHHHHHcTT######################################################################################################################################################################################################################################################################################################################################## PSIPRED ccHHHHHHHHHHHccEEEEEcHHHHccccccccHHHHHHHHcHHHccEEEccccccccccccEEEcccccccEEEEcHHHccccccHHHHccHHHHHHcccccccHHHHHHHHccccccEEEccccccccccccccccccHHHHHccccccEEccEEEEEccccccccccccccEEEEccccccccHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccHHHHHcHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEHHHcccccHHHHHcccccEEEccccccccEEEEEcHHHcccccccHHHcccccEEEcccccHHHHHHccccEEEccccccccccc //