[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56879.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->64 PF03543 * Peptidase_C58 0.00095 30.2 53/204  
:BLT:SWISS 1->88 AROK_DEHE1 4e-04 36.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56879.1 GT:GENE ACV56879.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(3409966..3410244) GB:FROM 3409966 GB:TO 3410244 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56879.1 GB:DB_XREF GI:257476559 LENGTH 92 SQ:AASEQ MGFMGTGKSAEDKALEKLATYLENMDLRPKDGMVHAGAFEMAGGYSRKNTSRILNGVLEFMQKQGYEILDVQLSPSGMGDSLLCCLVLITYK GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 1->88|AROK_DEHE1|4e-04|36.9|84/100| HM:PFM:NREP 1 HM:PFM:REP 10->64|PF03543|0.00095|30.2|53/204|Peptidase_C58| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 67-67,73-74,76-76| PSIPRED cccccccccHHHHHHHHHHHHHHcccccccccEEEccHHHHccccccccHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHEEEEEEEEc //